BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31200 (392 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 23 4.0 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 23.0 bits (47), Expect = 4.0 Identities = 12/36 (33%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = +2 Query: 107 TNCQ*L-CDVPYSVSVCKET*ILFIWLLALCLCVSK 211 TNC C+ P+SV + ++ + + LC C SK Sbjct: 1147 TNCHSSGCERPFSVQKIPNSNLILLVVDVLCPCGSK 1182 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 381,358 Number of Sequences: 2352 Number of extensions: 6796 Number of successful extensions: 8 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 30784536 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -