BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31198 (655 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43059| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_59634| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 8e-09 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) 49 4e-06 SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_1027| Best HMM Match : Carb_anhydrase (HMM E-Value=0) 47 1e-05 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_6419| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 46 2e-05 SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_36087| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 46 4e-05 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_25872| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_15671| Best HMM Match : DUF765 (HMM E-Value=9.6) 46 4e-05 SB_7555| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_1736| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 45 5e-05 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_40947| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_36834| Best HMM Match : Rap_GAP (HMM E-Value=0.00045) 45 6e-05 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 45 6e-05 SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_1971| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 44 8e-05 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 44 8e-05 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) 44 8e-05 SB_34798| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_32855| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_32799| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_22418| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) 44 8e-05 SB_16924| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) 44 8e-05 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 44 8e-05 SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_343| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 44 1e-04 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_14180| Best HMM Match : ERp29_N (HMM E-Value=3.4) 44 1e-04 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 44 1e-04 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 44 1e-04 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 44 1e-04 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) 44 1e-04 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_46791| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 44 1e-04 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_38625| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_34241| Best HMM Match : RuvA_C (HMM E-Value=1.5) 44 1e-04 SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_27240| Best HMM Match : DUF765 (HMM E-Value=9.1) 44 1e-04 SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_22502| Best HMM Match : FtsL (HMM E-Value=0.0086) 44 1e-04 SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_18776| Best HMM Match : DUF765 (HMM E-Value=4) 44 1e-04 SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_14019| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) 44 1e-04 SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 44 1e-04 SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 44 1e-04 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 44 1e-04 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 44 1e-04 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 44 1e-04 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 44 1e-04 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 44 1e-04 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 44 1e-04 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_51374| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_48900| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_44611| Best HMM Match : DUF765 (HMM E-Value=2.6) 44 1e-04 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_42248| Best HMM Match : Keratin_B2 (HMM E-Value=4.4) 44 1e-04 SB_38487| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) 44 1e-04 SB_30190| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_29318| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_18933| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_17005| Best HMM Match : DUF765 (HMM E-Value=7.4) 44 1e-04 SB_16044| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_7956| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_1885| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_1746| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 43 2e-04 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 43 2e-04 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_43468| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 43 2e-04 SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_39410| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_39260| Best HMM Match : DUF765 (HMM E-Value=9.6) 43 2e-04 SB_39012| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_30656| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_29965| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_26870| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_23253| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_23203| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_22547| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_20200| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_20053| Best HMM Match : DUF765 (HMM E-Value=3.9) 43 2e-04 SB_19538| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_17133| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_16339| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_15013| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_13185| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 43 2e-04 SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_8422| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_5594| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_4499| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_2728| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) 43 2e-04 SB_1805| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_175| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 43 3e-04 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 43 3e-04 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 43 3e-04 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 43 3e-04 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 43 3e-04 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 43 3e-04 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 43 3e-04 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 43 3e-04 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 43 3e-04 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 43 3e-04 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 43 3e-04 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 43 3e-04 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 43 3e-04 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 43 3e-04 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 43 3e-04 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 43 3e-04 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 43 3e-04 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 43 3e-04 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 43 3e-04 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 43 3e-04 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 43 3e-04 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 43 3e-04 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 43 3e-04 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_58237| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) 43 3e-04 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_55086| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 43 3e-04 SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_54383| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_54347| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 >SB_43059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 722 Score = 63.3 bits (147), Expect = 2e-10 Identities = 40/147 (27%), Positives = 67/147 (45%), Gaps = 1/147 (0%) Frame = +2 Query: 152 SIVNPGYCWRVDENGYDS-ELKGGPLNNDVYKLQQWHCHWGALNGEGSEHTVDGRSFSGE 328 S+ N G+ ++V+ + + GG L Y Q+H HWG+ N +GSEH +DG++F+G Sbjct: 486 SLKNNGHAFQVNMLSAGTFTVSGGGLGA-TYSTVQFHLHWGSKNEQGSEHLIDGKAFAGA 544 Query: 329 LHLVHWNTKQVPQLLGGGGKTKWTSRPRVLLMVWVGTPTAR*SCTGTAFRASQRR*SYIL 508 +H+V +NTK P + K+ + +LL V + + Sbjct: 545 IHIVSYNTK-YPNISAAVDKSDGLAVVGILLKVGTESAALKKFMENIGSVTKVNTSDEFA 603 Query: 509 LAPRPCQAASTKTAYWTYPGSLTTPPC 589 + + ++ Y GSLTTP C Sbjct: 604 QPAKLGDLLPSNKNFYRYQGSLTTPGC 630 Score = 33.1 bits (72), Expect = 0.20 Identities = 28/100 (28%), Positives = 40/100 (40%) Frame = +3 Query: 354 SKYHNFWEAGGKPNGLAALESY*WFGSEHPQLDKVVQVLPFVPHKGDKVTFC*PLDPAKL 533 +KY N A K +GLA + G+E L K ++ + V F P L Sbjct: 552 TKYPNISAAVDKSDGLAVVGILLKVGTESAALKKFMENIGSVTKVNTSDEFAQPAKLGDL 611 Query: 534 LPPRQLTGRTQGL*QHHPAPESGIWLLFF*PVQISAEQLS 653 LP + R QG ES W + P+ +S QL+ Sbjct: 612 LPSNKNFYRYQGSLTTPGCQESVTWSVMANPITVSEAQLA 651 >SB_59634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 361 Score = 57.6 bits (133), Expect = 8e-09 Identities = 23/48 (47%), Positives = 33/48 (68%) Frame = +2 Query: 209 LKGGPLNNDVYKLQQWHCHWGALNGEGSEHTVDGRSFSGELHLVHWNT 352 + GPL++ YK Q+H HWG EGSEH VDG+ + E+H+VH+N+ Sbjct: 2 ITSGPLSHK-YKFAQFHFHWGKDEKEGSEHRVDGKMYPSEMHIVHYNS 48 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 49.2 bits (112), Expect = 3e-06 Identities = 21/32 (65%), Positives = 25/32 (78%) Frame = -2 Query: 102 PLLTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 PLL + L+ NSCSPGDPLV+ERPPPR S+ Sbjct: 46 PLLYTYIPLLSNSCSPGDPLVLERPPPRWSSN 77 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 49.2 bits (112), Expect = 3e-06 Identities = 23/37 (62%), Positives = 28/37 (75%), Gaps = 2/37 (5%) Frame = -2 Query: 111 REAPLL--TREVTLVPNSCSPGDPLVIERPPPRGVSS 7 R PLL T ++L+ NSCSPGDPLV+ERPPPR S+ Sbjct: 21 RGPPLLRSTVSISLISNSCSPGDPLVLERPPPRWSSN 57 >SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) Length = 144 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/30 (63%), Positives = 26/30 (86%) Frame = -2 Query: 96 LTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 ++R+V++ NSCSPGDPLV+ERPPPR S+ Sbjct: 13 MSRKVSITSNSCSPGDPLVLERPPPRWSSN 42 >SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 48.0 bits (109), Expect = 7e-06 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = -2 Query: 93 TREVTLVPNSCSPGDPLVIERPPPRGVSS 7 T E T+ NSCSPGDPLV+ERPPPR S+ Sbjct: 41 TTESTITSNSCSPGDPLVLERPPPRWSSN 69 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 47.6 bits (108), Expect = 9e-06 Identities = 19/29 (65%), Positives = 24/29 (82%) Frame = -2 Query: 93 TREVTLVPNSCSPGDPLVIERPPPRGVSS 7 T ++L+ NSCSPGDPLV+ERPPPR S+ Sbjct: 28 TVSISLISNSCSPGDPLVLERPPPRWSSN 56 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 47.6 bits (108), Expect = 9e-06 Identities = 19/29 (65%), Positives = 24/29 (82%) Frame = -2 Query: 93 TREVTLVPNSCSPGDPLVIERPPPRGVSS 7 T ++L+ NSCSPGDPLV+ERPPPR S+ Sbjct: 28 TVSISLISNSCSPGDPLVLERPPPRWSSN 56 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 47.6 bits (108), Expect = 9e-06 Identities = 19/29 (65%), Positives = 24/29 (82%) Frame = -2 Query: 93 TREVTLVPNSCSPGDPLVIERPPPRGVSS 7 T ++L+ NSCSPGDPLV+ERPPPR S+ Sbjct: 28 TVSISLISNSCSPGDPLVLERPPPRWSSN 56 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 47.6 bits (108), Expect = 9e-06 Identities = 19/29 (65%), Positives = 24/29 (82%) Frame = -2 Query: 93 TREVTLVPNSCSPGDPLVIERPPPRGVSS 7 T ++L+ NSCSPGDPLV+ERPPPR S+ Sbjct: 28 TVSISLISNSCSPGDPLVLERPPPRWSSN 56 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 47.6 bits (108), Expect = 9e-06 Identities = 19/29 (65%), Positives = 24/29 (82%) Frame = -2 Query: 93 TREVTLVPNSCSPGDPLVIERPPPRGVSS 7 T ++L+ NSCSPGDPLV+ERPPPR S+ Sbjct: 28 TVSISLISNSCSPGDPLVLERPPPRWSSN 56 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 47.6 bits (108), Expect = 9e-06 Identities = 19/29 (65%), Positives = 24/29 (82%) Frame = -2 Query: 93 TREVTLVPNSCSPGDPLVIERPPPRGVSS 7 T ++L+ NSCSPGDPLV+ERPPPR S+ Sbjct: 28 TVSISLISNSCSPGDPLVLERPPPRWSSN 56 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 47.6 bits (108), Expect = 9e-06 Identities = 19/29 (65%), Positives = 24/29 (82%) Frame = -2 Query: 93 TREVTLVPNSCSPGDPLVIERPPPRGVSS 7 T ++L+ NSCSPGDPLV+ERPPPR S+ Sbjct: 28 TVSISLISNSCSPGDPLVLERPPPRWSSN 56 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 47.6 bits (108), Expect = 9e-06 Identities = 19/29 (65%), Positives = 24/29 (82%) Frame = -2 Query: 93 TREVTLVPNSCSPGDPLVIERPPPRGVSS 7 T ++L+ NSCSPGDPLV+ERPPPR S+ Sbjct: 26 TVSISLISNSCSPGDPLVLERPPPRWSSN 54 >SB_1027| Best HMM Match : Carb_anhydrase (HMM E-Value=0) Length = 291 Score = 47.2 bits (107), Expect = 1e-05 Identities = 36/118 (30%), Positives = 51/118 (43%), Gaps = 1/118 (0%) Frame = +2 Query: 239 YKLQQWHCHWGALNGEGSEHTVDGRSFSGELHLVHWNTKQVPQLLGGGGKTKWTSRPRVL 418 Y+L Q+H H G+ + +GSEH + G + E+HLVH+N K P G + VL Sbjct: 116 YRLAQFHFHVGSSDIQGSEHHIHGVKYPLEMHLVHYNDK-YPNASSAQGLLDGLAVISVL 174 Query: 419 LMVWVGTPTAR*SCTGTAFRASQRR*SYILLAPRPCQAASTKT-AYWTYPGSLTTPPC 589 A AS + + + T T ++ Y GSLTTPPC Sbjct: 175 FESSSTDNPALNEIIDNLQNASYKDEEITVQNVPVGKIIPTDTEKFYRYNGSLTTPPC 232 >SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/32 (59%), Positives = 24/32 (75%) Frame = -2 Query: 102 PLLTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 P + E+ + NSCSPGDPLV+ERPPPR S+ Sbjct: 69 PWIDHELRFLSNSCSPGDPLVLERPPPRWSSN 100 >SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1584 Score = 47.2 bits (107), Expect = 1e-05 Identities = 25/44 (56%), Positives = 29/44 (65%), Gaps = 4/44 (9%) Frame = -2 Query: 126 HF-NGGREAPLLTREVTLVP---NSCSPGDPLVIERPPPRGVSS 7 HF N G P +T+ L P NSCSPGDPLV+ERPPPR S+ Sbjct: 1172 HFGNYGMRRPQVTKGNDLKPFASNSCSPGDPLVLERPPPRWSSN 1215 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/26 (73%), Positives = 23/26 (88%) Frame = -2 Query: 84 VTLVPNSCSPGDPLVIERPPPRGVSS 7 V+L+ NSCSPGDPLV+ERPPPR S+ Sbjct: 31 VSLISNSCSPGDPLVLERPPPRWSSN 56 >SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/31 (61%), Positives = 24/31 (77%) Frame = -2 Query: 99 LLTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 ++ EV + NSCSPGDPLV+ERPPPR S+ Sbjct: 18 MVVTEVIITSNSCSPGDPLVLERPPPRWSSN 48 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 47.2 bits (107), Expect = 1e-05 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = -2 Query: 99 LLTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 +L+ LV NSCSPGDPLV+ERPPPR S+ Sbjct: 19 ILSPRARLVSNSCSPGDPLVLERPPPRWSSN 49 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 47.2 bits (107), Expect = 1e-05 Identities = 22/38 (57%), Positives = 25/38 (65%) Frame = -2 Query: 120 NGGREAPLLTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 N R LT +V NSCSPGDPLV+ERPPPR S+ Sbjct: 71 NDRRGEECLTLTQRIVSNSCSPGDPLVLERPPPRWSSN 108 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/34 (61%), Positives = 25/34 (73%) Frame = -2 Query: 108 EAPLLTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 E PLL + + NSCSPGDPLV+ERPPPR S+ Sbjct: 48 EWPLLIVVPSSISNSCSPGDPLVLERPPPRWSSN 81 >SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 46.8 bits (106), Expect = 2e-05 Identities = 19/25 (76%), Positives = 22/25 (88%) Frame = -2 Query: 81 TLVPNSCSPGDPLVIERPPPRGVSS 7 T+V NSCSPGDPLV+ERPPPR S+ Sbjct: 76 TIVSNSCSPGDPLVLERPPPRWSSN 100 >SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 46.8 bits (106), Expect = 2e-05 Identities = 19/26 (73%), Positives = 22/26 (84%) Frame = -2 Query: 84 VTLVPNSCSPGDPLVIERPPPRGVSS 7 VT+ NSCSPGDPLV+ERPPPR S+ Sbjct: 2 VTIASNSCSPGDPLVLERPPPRWSSN 27 >SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 46.8 bits (106), Expect = 2e-05 Identities = 19/26 (73%), Positives = 23/26 (88%) Frame = -2 Query: 84 VTLVPNSCSPGDPLVIERPPPRGVSS 7 +T+V NSCSPGDPLV+ERPPPR S+ Sbjct: 17 LTVVSNSCSPGDPLVLERPPPRWSSN 42 >SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 46.8 bits (106), Expect = 2e-05 Identities = 19/26 (73%), Positives = 22/26 (84%) Frame = -2 Query: 84 VTLVPNSCSPGDPLVIERPPPRGVSS 7 +T V NSCSPGDPLV+ERPPPR S+ Sbjct: 7 ITAVSNSCSPGDPLVLERPPPRWSSN 32 >SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 46.8 bits (106), Expect = 2e-05 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = -2 Query: 87 EVTLVPNSCSPGDPLVIERPPPRGVSS 7 EV L NSCSPGDPLV+ERPPPR S+ Sbjct: 8 EVYLASNSCSPGDPLVLERPPPRWSSN 34 >SB_6419| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 46.8 bits (106), Expect = 2e-05 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = -2 Query: 87 EVTLVPNSCSPGDPLVIERPPPRGVSS 7 EVT NSCSPGDPLV+ERPPPR S+ Sbjct: 46 EVTHTSNSCSPGDPLVLERPPPRWSSN 72 >SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 46.8 bits (106), Expect = 2e-05 Identities = 20/31 (64%), Positives = 23/31 (74%) Frame = -2 Query: 99 LLTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 L+ E L NSCSPGDPLV+ERPPPR S+ Sbjct: 4 LMAHESGLTSNSCSPGDPLVLERPPPRWSSN 34 >SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2070 Score = 46.4 bits (105), Expect = 2e-05 Identities = 19/26 (73%), Positives = 22/26 (84%) Frame = -2 Query: 84 VTLVPNSCSPGDPLVIERPPPRGVSS 7 VT + NSCSPGDPLV+ERPPPR S+ Sbjct: 512 VTFLSNSCSPGDPLVLERPPPRWSSN 537 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 46.4 bits (105), Expect = 2e-05 Identities = 19/25 (76%), Positives = 22/25 (88%) Frame = -2 Query: 81 TLVPNSCSPGDPLVIERPPPRGVSS 7 TL+ NSCSPGDPLV+ERPPPR S+ Sbjct: 61 TLLSNSCSPGDPLVLERPPPRWSSN 85 >SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 46.4 bits (105), Expect = 2e-05 Identities = 19/25 (76%), Positives = 22/25 (88%) Frame = -2 Query: 81 TLVPNSCSPGDPLVIERPPPRGVSS 7 TL+ NSCSPGDPLV+ERPPPR S+ Sbjct: 1 TLLSNSCSPGDPLVLERPPPRWSSN 25 >SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) Length = 190 Score = 46.4 bits (105), Expect = 2e-05 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = -2 Query: 99 LLTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 LL V ++ NSCSPGDPLV+ERPPPR S+ Sbjct: 58 LLALTVFMLSNSCSPGDPLVLERPPPRWSSN 88 >SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 240 Score = 46.4 bits (105), Expect = 2e-05 Identities = 19/32 (59%), Positives = 24/32 (75%) Frame = -2 Query: 102 PLLTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 P + R + + NSCSPGDPLV+ERPPPR S+ Sbjct: 107 PSIKRRLLGISNSCSPGDPLVLERPPPRWSSN 138 >SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 46.4 bits (105), Expect = 2e-05 Identities = 18/25 (72%), Positives = 22/25 (88%) Frame = -2 Query: 81 TLVPNSCSPGDPLVIERPPPRGVSS 7 T++ NSCSPGDPLV+ERPPPR S+ Sbjct: 3 TIISNSCSPGDPLVLERPPPRWSSN 27 >SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 46.4 bits (105), Expect = 2e-05 Identities = 19/26 (73%), Positives = 22/26 (84%) Frame = -2 Query: 84 VTLVPNSCSPGDPLVIERPPPRGVSS 7 +TL NSCSPGDPLV+ERPPPR S+ Sbjct: 1 MTLASNSCSPGDPLVLERPPPRWSSN 26 >SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 46.0 bits (104), Expect = 3e-05 Identities = 18/31 (58%), Positives = 24/31 (77%) Frame = -2 Query: 99 LLTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 L++ + + NSCSPGDPLV+ERPPPR S+ Sbjct: 8 LISANIVHISNSCSPGDPLVLERPPPRWSSN 38 >SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/31 (61%), Positives = 24/31 (77%) Frame = -2 Query: 99 LLTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 +L + L+ NSCSPGDPLV+ERPPPR S+ Sbjct: 1 MLYVRIYLISNSCSPGDPLVLERPPPRWSSN 31 >SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = -2 Query: 81 TLVPNSCSPGDPLVIERPPPRGVSS 7 TL NSCSPGDPLV+ERPPPR S+ Sbjct: 5 TLASNSCSPGDPLVLERPPPRWSSN 29 >SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/32 (62%), Positives = 25/32 (78%) Frame = -2 Query: 102 PLLTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 P LT ++ + NSCSPGDPLV+ERPPPR S+ Sbjct: 45 PNLTIDLHVRSNSCSPGDPLVLERPPPRWSSN 76 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 46.0 bits (104), Expect = 3e-05 Identities = 23/42 (54%), Positives = 29/42 (69%) Frame = -2 Query: 132 SRHFNGGREAPLLTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 +R G R++ L R + V NSCSPGDPLV+ERPPPR S+ Sbjct: 41 ARSPRGQRQSENL-RTIPPVSNSCSPGDPLVLERPPPRWSSN 81 >SB_36087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = -2 Query: 96 LTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 L RE + NSCSPGDPLV+ERPPPR S+ Sbjct: 6 LDRESYALSNSCSPGDPLVLERPPPRWSSN 35 >SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/29 (65%), Positives = 22/29 (75%) Frame = -2 Query: 93 TREVTLVPNSCSPGDPLVIERPPPRGVSS 7 TR + NSCSPGDPLV+ERPPPR S+ Sbjct: 20 TRHLQAASNSCSPGDPLVLERPPPRWSSN 48 >SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/32 (62%), Positives = 23/32 (71%) Frame = -2 Query: 102 PLLTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 P + R V NSCSPGDPLV+ERPPPR S+ Sbjct: 5 PFVFRVTLEVSNSCSPGDPLVLERPPPRWSSN 36 >SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/28 (67%), Positives = 22/28 (78%) Frame = -2 Query: 90 REVTLVPNSCSPGDPLVIERPPPRGVSS 7 + V V NSCSPGDPLV+ERPPPR S+ Sbjct: 18 KRVNAVSNSCSPGDPLVLERPPPRWSSN 45 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/26 (73%), Positives = 22/26 (84%) Frame = -2 Query: 84 VTLVPNSCSPGDPLVIERPPPRGVSS 7 V L+ NSCSPGDPLV+ERPPPR S+ Sbjct: 14 VFLISNSCSPGDPLVLERPPPRWSSN 39 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 45.6 bits (103), Expect = 4e-05 Identities = 19/24 (79%), Positives = 21/24 (87%) Frame = -2 Query: 78 LVPNSCSPGDPLVIERPPPRGVSS 7 LV NSCSPGDPLV+ERPPPR S+ Sbjct: 24 LVSNSCSPGDPLVLERPPPRWSSN 47 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/31 (58%), Positives = 23/31 (74%) Frame = -2 Query: 99 LLTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 L++ + NSCSPGDPLV+ERPPPR S+ Sbjct: 8 LISANICFTSNSCSPGDPLVLERPPPRWSSN 38 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 45.6 bits (103), Expect = 4e-05 Identities = 19/28 (67%), Positives = 22/28 (78%) Frame = -2 Query: 90 REVTLVPNSCSPGDPLVIERPPPRGVSS 7 R + V NSCSPGDPLV+ERPPPR S+ Sbjct: 10 RSASQVSNSCSPGDPLVLERPPPRWSSN 37 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 45.6 bits (103), Expect = 4e-05 Identities = 19/24 (79%), Positives = 21/24 (87%) Frame = -2 Query: 78 LVPNSCSPGDPLVIERPPPRGVSS 7 LV NSCSPGDPLV+ERPPPR S+ Sbjct: 3 LVSNSCSPGDPLVLERPPPRWSSN 26 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 45.6 bits (103), Expect = 4e-05 Identities = 19/24 (79%), Positives = 21/24 (87%) Frame = -2 Query: 78 LVPNSCSPGDPLVIERPPPRGVSS 7 LV NSCSPGDPLV+ERPPPR S+ Sbjct: 17 LVSNSCSPGDPLVLERPPPRWSSN 40 >SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 45.6 bits (103), Expect = 4e-05 Identities = 19/24 (79%), Positives = 21/24 (87%) Frame = -2 Query: 78 LVPNSCSPGDPLVIERPPPRGVSS 7 LV NSCSPGDPLV+ERPPPR S+ Sbjct: 9 LVSNSCSPGDPLVLERPPPRWSSN 32 >SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/26 (69%), Positives = 22/26 (84%) Frame = -2 Query: 84 VTLVPNSCSPGDPLVIERPPPRGVSS 7 + +V NSCSPGDPLV+ERPPPR S+ Sbjct: 5 IVVVSNSCSPGDPLVLERPPPRWSSN 30 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/26 (69%), Positives = 22/26 (84%) Frame = -2 Query: 84 VTLVPNSCSPGDPLVIERPPPRGVSS 7 + +V NSCSPGDPLV+ERPPPR S+ Sbjct: 9 IPMVSNSCSPGDPLVLERPPPRWSSN 34 >SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 45.6 bits (103), Expect = 4e-05 Identities = 19/28 (67%), Positives = 22/28 (78%) Frame = -2 Query: 90 REVTLVPNSCSPGDPLVIERPPPRGVSS 7 R L+ NSCSPGDPLV+ERPPPR S+ Sbjct: 2 RTAILLSNSCSPGDPLVLERPPPRWSSN 29 >SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 45.6 bits (103), Expect = 4e-05 Identities = 19/24 (79%), Positives = 21/24 (87%) Frame = -2 Query: 78 LVPNSCSPGDPLVIERPPPRGVSS 7 LV NSCSPGDPLV+ERPPPR S+ Sbjct: 5 LVSNSCSPGDPLVLERPPPRWSSN 28 >SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 45.6 bits (103), Expect = 4e-05 Identities = 19/24 (79%), Positives = 21/24 (87%) Frame = -2 Query: 78 LVPNSCSPGDPLVIERPPPRGVSS 7 LV NSCSPGDPLV+ERPPPR S+ Sbjct: 2 LVSNSCSPGDPLVLERPPPRWSSN 25 >SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 45.6 bits (103), Expect = 4e-05 Identities = 17/26 (65%), Positives = 22/26 (84%) Frame = -2 Query: 84 VTLVPNSCSPGDPLVIERPPPRGVSS 7 + ++ NSCSPGDPLV+ERPPPR S+ Sbjct: 3 IVIISNSCSPGDPLVLERPPPRWSSN 28 >SB_25872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/27 (66%), Positives = 22/27 (81%) Frame = -2 Query: 87 EVTLVPNSCSPGDPLVIERPPPRGVSS 7 ++T NSCSPGDPLV+ERPPPR S+ Sbjct: 17 DLTFTSNSCSPGDPLVLERPPPRWSSN 43 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 45.6 bits (103), Expect = 4e-05 Identities = 19/24 (79%), Positives = 21/24 (87%) Frame = -2 Query: 78 LVPNSCSPGDPLVIERPPPRGVSS 7 LV NSCSPGDPLV+ERPPPR S+ Sbjct: 26 LVSNSCSPGDPLVLERPPPRWSSN 49 >SB_15671| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 139 Score = 45.6 bits (103), Expect = 4e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = -2 Query: 93 TREVTLVPNSCSPGDPLVIERPPPRGVSS 7 T VT NSCSPGDPLV+ERPPPR S+ Sbjct: 9 TNLVTASSNSCSPGDPLVLERPPPRWSSN 37 >SB_7555| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 45.6 bits (103), Expect = 4e-05 Identities = 19/28 (67%), Positives = 22/28 (78%) Frame = -2 Query: 90 REVTLVPNSCSPGDPLVIERPPPRGVSS 7 R V + NSCSPGDPLV+ERPPPR S+ Sbjct: 46 RRVYVTSNSCSPGDPLVLERPPPRWSSN 73 >SB_1736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/31 (58%), Positives = 24/31 (77%) Frame = -2 Query: 99 LLTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 L++ ++ NSCSPGDPLV+ERPPPR S+ Sbjct: 8 LISANISQTSNSCSPGDPLVLERPPPRWSSN 38 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 45.2 bits (102), Expect = 5e-05 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 84 VTLVPNSCSPGDPLVIERPPPRGVSS 7 +T NSCSPGDPLV+ERPPPR S+ Sbjct: 6 ITTTSNSCSPGDPLVLERPPPRWSSN 31 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 45.2 bits (102), Expect = 5e-05 Identities = 18/25 (72%), Positives = 22/25 (88%) Frame = -2 Query: 81 TLVPNSCSPGDPLVIERPPPRGVSS 7 ++V NSCSPGDPLV+ERPPPR S+ Sbjct: 346 SIVSNSCSPGDPLVLERPPPRWSSN 370 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 45.2 bits (102), Expect = 5e-05 Identities = 21/36 (58%), Positives = 24/36 (66%) Frame = -2 Query: 114 GREAPLLTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 G A L E+ NSCSPGDPLV+ERPPPR S+ Sbjct: 17 GLPAVLGAPELLTASNSCSPGDPLVLERPPPRWSSN 52 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 45.2 bits (102), Expect = 5e-05 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = -2 Query: 78 LVPNSCSPGDPLVIERPPPRGVSS 7 L+ NSCSPGDPLV+ERPPPR S+ Sbjct: 17 LISNSCSPGDPLVLERPPPRWSSN 40 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 45.2 bits (102), Expect = 5e-05 Identities = 19/26 (73%), Positives = 21/26 (80%) Frame = -2 Query: 84 VTLVPNSCSPGDPLVIERPPPRGVSS 7 V V NSCSPGDPLV+ERPPPR S+ Sbjct: 7 VLFVSNSCSPGDPLVLERPPPRWSSN 32 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 45.2 bits (102), Expect = 5e-05 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = -2 Query: 78 LVPNSCSPGDPLVIERPPPRGVSS 7 L+ NSCSPGDPLV+ERPPPR S+ Sbjct: 37 LISNSCSPGDPLVLERPPPRWSSN 60 >SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 45.2 bits (102), Expect = 5e-05 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 84 VTLVPNSCSPGDPLVIERPPPRGVSS 7 + V NSCSPGDPLV+ERPPPR S+ Sbjct: 16 IAFVSNSCSPGDPLVLERPPPRWSSN 41 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 45.2 bits (102), Expect = 5e-05 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = -2 Query: 78 LVPNSCSPGDPLVIERPPPRGVSS 7 L+ NSCSPGDPLV+ERPPPR S+ Sbjct: 24 LISNSCSPGDPLVLERPPPRWSSN 47 >SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 45.2 bits (102), Expect = 5e-05 Identities = 18/25 (72%), Positives = 22/25 (88%) Frame = -2 Query: 81 TLVPNSCSPGDPLVIERPPPRGVSS 7 T++ NSCSPGDPLV+ERPPPR S+ Sbjct: 18 TVLSNSCSPGDPLVLERPPPRWSSN 42 >SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 45.2 bits (102), Expect = 5e-05 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = -2 Query: 78 LVPNSCSPGDPLVIERPPPRGVSS 7 L+ NSCSPGDPLV+ERPPPR S+ Sbjct: 40 LISNSCSPGDPLVLERPPPRWSSN 63 >SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 45.2 bits (102), Expect = 5e-05 Identities = 21/31 (67%), Positives = 25/31 (80%) Frame = -2 Query: 99 LLTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 L T+E+T NSCSPGDPLV+ERPPPR S+ Sbjct: 6 LCTQELT--SNSCSPGDPLVLERPPPRWSSN 34 >SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 45.2 bits (102), Expect = 5e-05 Identities = 19/26 (73%), Positives = 22/26 (84%) Frame = -2 Query: 84 VTLVPNSCSPGDPLVIERPPPRGVSS 7 V+L NSCSPGDPLV+ERPPPR S+ Sbjct: 4 VSLSSNSCSPGDPLVLERPPPRWSSN 29 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 45.2 bits (102), Expect = 5e-05 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = -2 Query: 78 LVPNSCSPGDPLVIERPPPRGVSS 7 L+ NSCSPGDPLV+ERPPPR S+ Sbjct: 70 LISNSCSPGDPLVLERPPPRWSSN 93 >SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 45.2 bits (102), Expect = 5e-05 Identities = 19/26 (73%), Positives = 22/26 (84%) Frame = -2 Query: 84 VTLVPNSCSPGDPLVIERPPPRGVSS 7 V+ V NSCSPGDPLV+ERPPPR S+ Sbjct: 14 VSKVSNSCSPGDPLVLERPPPRWSSN 39 >SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 45.2 bits (102), Expect = 5e-05 Identities = 18/29 (62%), Positives = 22/29 (75%) Frame = -2 Query: 93 TREVTLVPNSCSPGDPLVIERPPPRGVSS 7 T ++ NSCSPGDPLV+ERPPPR S+ Sbjct: 12 TTSAPVISNSCSPGDPLVLERPPPRWSSN 40 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 45.2 bits (102), Expect = 5e-05 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = -2 Query: 78 LVPNSCSPGDPLVIERPPPRGVSS 7 L+ NSCSPGDPLV+ERPPPR S+ Sbjct: 21 LISNSCSPGDPLVLERPPPRWSSN 44 >SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 45.2 bits (102), Expect = 5e-05 Identities = 19/29 (65%), Positives = 23/29 (79%) Frame = -2 Query: 93 TREVTLVPNSCSPGDPLVIERPPPRGVSS 7 T ++ V NSCSPGDPLV+ERPPPR S+ Sbjct: 3 TSKMLRVSNSCSPGDPLVLERPPPRWSSN 31 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/31 (58%), Positives = 23/31 (74%) Frame = -2 Query: 99 LLTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 L + ++ NSCSPGDPLV+ERPPPR S+ Sbjct: 10 LRVQRFRIISNSCSPGDPLVLERPPPRWSSN 40 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 44.8 bits (101), Expect = 6e-05 Identities = 19/27 (70%), Positives = 22/27 (81%) Frame = -2 Query: 87 EVTLVPNSCSPGDPLVIERPPPRGVSS 7 EV + NSCSPGDPLV+ERPPPR S+ Sbjct: 60 EVQPLSNSCSPGDPLVLERPPPRWSSN 86 >SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/32 (62%), Positives = 25/32 (78%), Gaps = 1/32 (3%) Frame = -2 Query: 99 LLTREVTLVP-NSCSPGDPLVIERPPPRGVSS 7 L++ +T P NSCSPGDPLV+ERPPPR S+ Sbjct: 8 LISANITWRPSNSCSPGDPLVLERPPPRWSSN 39 >SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.8 bits (101), Expect = 6e-05 Identities = 17/29 (58%), Positives = 24/29 (82%) Frame = -2 Query: 93 TREVTLVPNSCSPGDPLVIERPPPRGVSS 7 +++++ NSCSPGDPLV+ERPPPR S+ Sbjct: 28 SQDISKTSNSCSPGDPLVLERPPPRWSSN 56 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 44.8 bits (101), Expect = 6e-05 Identities = 21/29 (72%), Positives = 23/29 (79%), Gaps = 1/29 (3%) Frame = -2 Query: 90 REVTL-VPNSCSPGDPLVIERPPPRGVSS 7 RE L V NSCSPGDPLV+ERPPPR S+ Sbjct: 34 REFVLRVSNSCSPGDPLVLERPPPRWSSN 62 >SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 44.8 bits (101), Expect = 6e-05 Identities = 25/41 (60%), Positives = 28/41 (68%) Frame = -1 Query: 130 PPFQWRQGSSTFDARSHPRAEFLQPGGSTSYRAAATAGSLQ 8 PP++ +ST S PR EFLQPGGSTS RAAATA LQ Sbjct: 24 PPWKMVVNAST-SFGSDPRIEFLQPGGSTSSRAAATAVELQ 63 >SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 44.8 bits (101), Expect = 6e-05 Identities = 19/30 (63%), Positives = 22/30 (73%) Frame = -2 Query: 96 LTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 L R + NSCSPGDPLV+ERPPPR S+ Sbjct: 83 LLRPCIVTSNSCSPGDPLVLERPPPRWSSN 112 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 84 VTLVPNSCSPGDPLVIERPPPRGVSS 7 + L NSCSPGDPLV+ERPPPR S+ Sbjct: 76 ILLTSNSCSPGDPLVLERPPPRWSSN 101 >SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 44.8 bits (101), Expect = 6e-05 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = -2 Query: 81 TLVPNSCSPGDPLVIERPPPRGVSS 7 TL NSCSPGDPLV+ERPPPR S+ Sbjct: 13 TLRSNSCSPGDPLVLERPPPRWSSN 37 >SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 44.8 bits (101), Expect = 6e-05 Identities = 19/31 (61%), Positives = 22/31 (70%) Frame = -2 Query: 99 LLTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 L+ T NSCSPGDPLV+ERPPPR S+ Sbjct: 27 LIVPNATAQSNSCSPGDPLVLERPPPRWSSN 57 >SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 84 VTLVPNSCSPGDPLVIERPPPRGVSS 7 +T NSCSPGDPLV+ERPPPR S+ Sbjct: 35 ITSTSNSCSPGDPLVLERPPPRWSSN 60 >SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/35 (57%), Positives = 24/35 (68%) Frame = -2 Query: 111 REAPLLTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 RE + V + NSCSPGDPLV+ERPPPR S+ Sbjct: 44 REDLFSLQHVRALSNSCSPGDPLVLERPPPRWSSN 78 >SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = -2 Query: 78 LVPNSCSPGDPLVIERPPPRGVSS 7 +V NSCSPGDPLV+ERPPPR S+ Sbjct: 1 MVSNSCSPGDPLVLERPPPRWSSN 24 >SB_40947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 44.8 bits (101), Expect = 6e-05 Identities = 22/46 (47%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = -2 Query: 141 LTESRHFNGGREAPLLTREVTLVP-NSCSPGDPLVIERPPPRGVSS 7 L S H + P + + +P NSCSPGDPLV+ERPPPR S+ Sbjct: 12 LIPSLHTSQALHHPFIQAKPYNIPSNSCSPGDPLVLERPPPRWSSN 57 >SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/32 (62%), Positives = 25/32 (78%), Gaps = 1/32 (3%) Frame = -2 Query: 99 LLTREVTLVP-NSCSPGDPLVIERPPPRGVSS 7 ++T + VP NSCSPGDPLV+ERPPPR S+ Sbjct: 4 VITLSLGFVPSNSCSPGDPLVLERPPPRWSSN 35 >SB_36834| Best HMM Match : Rap_GAP (HMM E-Value=0.00045) Length = 545 Score = 44.8 bits (101), Expect = 6e-05 Identities = 21/36 (58%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = -2 Query: 111 REAPLLTREVTL-VPNSCSPGDPLVIERPPPRGVSS 7 R P L R + NSCSPGDPLV+ERPPPR S+ Sbjct: 239 RVLPSLVRATAINASNSCSPGDPLVLERPPPRWSSN 274 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 84 VTLVPNSCSPGDPLVIERPPPRGVSS 7 + L NSCSPGDPLV+ERPPPR S+ Sbjct: 9 IMLASNSCSPGDPLVLERPPPRWSSN 34 >SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = -2 Query: 78 LVPNSCSPGDPLVIERPPPRGVSS 7 +V NSCSPGDPLV+ERPPPR S+ Sbjct: 13 IVSNSCSPGDPLVLERPPPRWSSN 36 >SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) Length = 176 Score = 44.8 bits (101), Expect = 6e-05 Identities = 17/26 (65%), Positives = 21/26 (80%) Frame = -2 Query: 84 VTLVPNSCSPGDPLVIERPPPRGVSS 7 + + NSCSPGDPLV+ERPPPR S+ Sbjct: 49 IAFISNSCSPGDPLVLERPPPRWSSN 74 >SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = -2 Query: 78 LVPNSCSPGDPLVIERPPPRGVSS 7 +V NSCSPGDPLV+ERPPPR S+ Sbjct: 6 IVSNSCSPGDPLVLERPPPRWSSN 29 >SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = -2 Query: 78 LVPNSCSPGDPLVIERPPPRGVSS 7 +V NSCSPGDPLV+ERPPPR S+ Sbjct: 1 MVSNSCSPGDPLVLERPPPRWSSN 24 >SB_1971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.8 bits (101), Expect = 6e-05 Identities = 21/31 (67%), Positives = 25/31 (80%) Frame = -2 Query: 99 LLTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 L+TR V+ NSCSPGDPLV+ERPPPR S+ Sbjct: 6 LITRGVS--SNSCSPGDPLVLERPPPRWSSN 34 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 44.4 bits (100), Expect = 8e-05 Identities = 21/32 (65%), Positives = 24/32 (75%), Gaps = 3/32 (9%) Frame = -2 Query: 93 TREVTLVP---NSCSPGDPLVIERPPPRGVSS 7 T +LVP NSCSPGDPLV+ERPPPR S+ Sbjct: 17 TNGASLVPRPSNSCSPGDPLVLERPPPRWSSN 48 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 84 VTLVPNSCSPGDPLVIERPPPRGVSS 7 V + NSCSPGDPLV+ERPPPR S+ Sbjct: 44 VVVTSNSCSPGDPLVLERPPPRWSSN 69 >SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = -2 Query: 81 TLVPNSCSPGDPLVIERPPPRGVSS 7 T+ NSCSPGDPLV+ERPPPR S+ Sbjct: 10 TISSNSCSPGDPLVLERPPPRWSSN 34 >SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) Length = 166 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/31 (58%), Positives = 23/31 (74%) Frame = -2 Query: 99 LLTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 L ++ + NSCSPGDPLV+ERPPPR S+ Sbjct: 34 LCLKQANVPSNSCSPGDPLVLERPPPRWSSN 64 >SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 44.4 bits (100), Expect = 8e-05 Identities = 22/43 (51%), Positives = 27/43 (62%), Gaps = 2/43 (4%) Frame = -2 Query: 129 RHFNGGREAPLLTREVTLVP--NSCSPGDPLVIERPPPRGVSS 7 +HF + +TR P NSCSPGDPLV+ERPPPR S+ Sbjct: 2 KHFTDTLISANITRVTNSRPRSNSCSPGDPLVLERPPPRWSSN 44 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 44.4 bits (100), Expect = 8e-05 Identities = 17/24 (70%), Positives = 21/24 (87%) Frame = -2 Query: 78 LVPNSCSPGDPLVIERPPPRGVSS 7 ++ NSCSPGDPLV+ERPPPR S+ Sbjct: 119 IISNSCSPGDPLVLERPPPRWSSN 142 >SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/31 (58%), Positives = 23/31 (74%) Frame = -2 Query: 99 LLTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 L++ + NSCSPGDPLV+ERPPPR S+ Sbjct: 8 LISANIGKTSNSCSPGDPLVLERPPPRWSSN 38 >SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/31 (58%), Positives = 23/31 (74%) Frame = -2 Query: 99 LLTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 L++ + NSCSPGDPLV+ERPPPR S+ Sbjct: 8 LISANIKFRSNSCSPGDPLVLERPPPRWSSN 38 >SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) Length = 129 Score = 44.4 bits (100), Expect = 8e-05 Identities = 19/26 (73%), Positives = 21/26 (80%) Frame = -2 Query: 84 VTLVPNSCSPGDPLVIERPPPRGVSS 7 VT NSCSPGDPLV+ERPPPR S+ Sbjct: 2 VTSPSNSCSPGDPLVLERPPPRWSSN 27 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = -2 Query: 78 LVPNSCSPGDPLVIERPPPRGVSS 7 +V NSCSPGDPLV+ERPPPR S+ Sbjct: 3474 VVSNSCSPGDPLVLERPPPRWSSN 3497 >SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 44.4 bits (100), Expect = 8e-05 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = -2 Query: 87 EVTLVPNSCSPGDPLVIERPPPRGVSS 7 E V NSCSPGDPLV+ERPPPR S+ Sbjct: 3 EALHVSNSCSPGDPLVLERPPPRWSSN 29 >SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -2 Query: 90 REVTLVPNSCSPGDPLVIERPPPRGVSS 7 + V + NSCSPGDPLV+ERPPPR S+ Sbjct: 30 KPVIFLSNSCSPGDPLVLERPPPRWSSN 57 >SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/28 (64%), Positives = 21/28 (75%) Frame = -2 Query: 90 REVTLVPNSCSPGDPLVIERPPPRGVSS 7 + V NSCSPGDPLV+ERPPPR S+ Sbjct: 23 KHVKFTSNSCSPGDPLVLERPPPRWSSN 50 >SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 44.4 bits (100), Expect = 8e-05 Identities = 17/24 (70%), Positives = 21/24 (87%) Frame = -2 Query: 78 LVPNSCSPGDPLVIERPPPRGVSS 7 ++ NSCSPGDPLV+ERPPPR S+ Sbjct: 14 IISNSCSPGDPLVLERPPPRWSSN 37 >SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.4 bits (100), Expect = 8e-05 Identities = 17/24 (70%), Positives = 21/24 (87%) Frame = -2 Query: 78 LVPNSCSPGDPLVIERPPPRGVSS 7 ++ NSCSPGDPLV+ERPPPR S+ Sbjct: 13 IISNSCSPGDPLVLERPPPRWSSN 36 >SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) Length = 138 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = -2 Query: 81 TLVPNSCSPGDPLVIERPPPRGVSS 7 + V NSCSPGDPLV+ERPPPR S+ Sbjct: 12 SFVSNSCSPGDPLVLERPPPRWSSN 36 >SB_34798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -2 Query: 90 REVTLVPNSCSPGDPLVIERPPPRGVSS 7 R++ NSCSPGDPLV+ERPPPR S+ Sbjct: 8 RQLKKASNSCSPGDPLVLERPPPRWSSN 35 >SB_32855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/31 (58%), Positives = 23/31 (74%) Frame = -2 Query: 99 LLTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 L++ + NSCSPGDPLV+ERPPPR S+ Sbjct: 8 LISANILHASNSCSPGDPLVLERPPPRWSSN 38 >SB_32799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = -2 Query: 81 TLVPNSCSPGDPLVIERPPPRGVSS 7 T NSCSPGDPLV+ERPPPR S+ Sbjct: 3 TFTSNSCSPGDPLVLERPPPRWSSN 27 >SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = -2 Query: 81 TLVPNSCSPGDPLVIERPPPRGVSS 7 T+ NSCSPGDPLV+ERPPPR S+ Sbjct: 22 TISSNSCSPGDPLVLERPPPRWSSN 46 >SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 44.4 bits (100), Expect = 8e-05 Identities = 17/24 (70%), Positives = 21/24 (87%) Frame = -2 Query: 78 LVPNSCSPGDPLVIERPPPRGVSS 7 ++ NSCSPGDPLV+ERPPPR S+ Sbjct: 1 MISNSCSPGDPLVLERPPPRWSSN 24 >SB_22418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 44.4 bits (100), Expect = 8e-05 Identities = 19/33 (57%), Positives = 24/33 (72%) Frame = -2 Query: 105 APLLTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 A + T+ + NSCSPGDPLV+ERPPPR S+ Sbjct: 11 ANINTQSKLVASNSCSPGDPLVLERPPPRWSSN 43 >SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 84 VTLVPNSCSPGDPLVIERPPPRGVSS 7 + V NSCSPGDPLV+ERPPPR S+ Sbjct: 31 ICTVSNSCSPGDPLVLERPPPRWSSN 56 >SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) Length = 802 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 84 VTLVPNSCSPGDPLVIERPPPRGVSS 7 V + NSCSPGDPLV+ERPPPR S+ Sbjct: 87 VMTISNSCSPGDPLVLERPPPRWSSN 112 >SB_16924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/31 (58%), Positives = 23/31 (74%) Frame = -2 Query: 99 LLTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 L++ + NSCSPGDPLV+ERPPPR S+ Sbjct: 8 LISANIRNTSNSCSPGDPLVLERPPPRWSSN 38 >SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = -2 Query: 78 LVPNSCSPGDPLVIERPPPRGVSS 7 L+ NSCSPGDPLV+ERPPPR S+ Sbjct: 1 LLSNSCSPGDPLVLERPPPRWSSN 24 >SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 44.4 bits (100), Expect = 8e-05 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = -2 Query: 105 APLLTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 A + R + NSCSPGDPLV+ERPPPR S+ Sbjct: 11 ANIRLRGICAASNSCSPGDPLVLERPPPRWSSN 43 >SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 44.4 bits (100), Expect = 8e-05 Identities = 20/25 (80%), Positives = 22/25 (88%), Gaps = 1/25 (4%) Frame = -2 Query: 78 LVP-NSCSPGDPLVIERPPPRGVSS 7 LVP NSCSPGDPLV+ERPPPR S+ Sbjct: 27 LVPSNSCSPGDPLVLERPPPRWSSN 51 >SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = -2 Query: 78 LVPNSCSPGDPLVIERPPPRGVSS 7 L+ NSCSPGDPLV+ERPPPR S+ Sbjct: 7 LLSNSCSPGDPLVLERPPPRWSSN 30 >SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) Length = 140 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = -2 Query: 81 TLVPNSCSPGDPLVIERPPPRGVSS 7 +L NSCSPGDPLV+ERPPPR S+ Sbjct: 14 SLTSNSCSPGDPLVLERPPPRWSSN 38 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/30 (60%), Positives = 22/30 (73%) Frame = -2 Query: 96 LTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 + + L NSCSPGDPLV+ERPPPR S+ Sbjct: 655 ILNSLQLASNSCSPGDPLVLERPPPRWSSN 684 >SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = -2 Query: 78 LVPNSCSPGDPLVIERPPPRGVSS 7 +V NSCSPGDPLV+ERPPPR S+ Sbjct: 27 VVSNSCSPGDPLVLERPPPRWSSN 50 >SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.4 bits (100), Expect = 8e-05 Identities = 17/24 (70%), Positives = 21/24 (87%) Frame = -2 Query: 78 LVPNSCSPGDPLVIERPPPRGVSS 7 ++ NSCSPGDPLV+ERPPPR S+ Sbjct: 13 IISNSCSPGDPLVLERPPPRWSSN 36 >SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 44.4 bits (100), Expect = 8e-05 Identities = 17/24 (70%), Positives = 21/24 (87%) Frame = -2 Query: 78 LVPNSCSPGDPLVIERPPPRGVSS 7 ++ NSCSPGDPLV+ERPPPR S+ Sbjct: 26 IISNSCSPGDPLVLERPPPRWSSN 49 >SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 84 VTLVPNSCSPGDPLVIERPPPRGVSS 7 + V NSCSPGDPLV+ERPPPR S+ Sbjct: 7 INSVSNSCSPGDPLVLERPPPRWSSN 32 >SB_343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 44.4 bits (100), Expect = 8e-05 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = -2 Query: 96 LTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 L R V NSCSPGDPLV+ERPPPR S+ Sbjct: 64 LYRYVMTPSNSCSPGDPLVLERPPPRWSSN 93 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/29 (62%), Positives = 22/29 (75%) Frame = -2 Query: 93 TREVTLVPNSCSPGDPLVIERPPPRGVSS 7 T + + NSCSPGDPLV+ERPPPR S+ Sbjct: 95 TNKSLKISNSCSPGDPLVLERPPPRWSSN 123 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 V NSCSPGDPLV+ERPPPR S+ Sbjct: 30 VSNSCSPGDPLVLERPPPRWSSN 52 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 V NSCSPGDPLV+ERPPPR S+ Sbjct: 7 VSNSCSPGDPLVLERPPPRWSSN 29 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 44.0 bits (99), Expect = 1e-04 Identities = 19/34 (55%), Positives = 22/34 (64%) Frame = -2 Query: 108 EAPLLTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 E L + NSCSPGDPLV+ERPPPR S+ Sbjct: 42 EPAFLAEGFRVASNSCSPGDPLVLERPPPRWSSN 75 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 84 VTLVPNSCSPGDPLVIERPPPRGVSS 7 V + NSCSPGDPLV+ERPPPR S+ Sbjct: 13 VQQISNSCSPGDPLVLERPPPRWSSN 38 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/31 (58%), Positives = 23/31 (74%) Frame = -2 Query: 99 LLTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 L++ + NSCSPGDPLV+ERPPPR S+ Sbjct: 8 LISANIFFRSNSCSPGDPLVLERPPPRWSSN 38 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 44.0 bits (99), Expect = 1e-04 Identities = 21/33 (63%), Positives = 24/33 (72%), Gaps = 1/33 (3%) Frame = -2 Query: 102 PLLTREVTLVP-NSCSPGDPLVIERPPPRGVSS 7 P L+ LV NSCSPGDPLV+ERPPPR S+ Sbjct: 882 PSLSHPFPLVTSNSCSPGDPLVLERPPPRWSSN 914 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 V NSCSPGDPLV+ERPPPR S+ Sbjct: 2 VSNSCSPGDPLVLERPPPRWSSN 24 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -2 Query: 78 LVPNSCSPGDPLVIERPPPRGVSS 7 L NSCSPGDPLV+ERPPPR S+ Sbjct: 15 LTSNSCSPGDPLVLERPPPRWSSN 38 >SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/26 (69%), Positives = 22/26 (84%) Frame = -2 Query: 84 VTLVPNSCSPGDPLVIERPPPRGVSS 7 +T+ NSCSPGDPLV+ERPPPR S+ Sbjct: 8 LTVGSNSCSPGDPLVLERPPPRWSSN 33 >SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 V NSCSPGDPLV+ERPPPR S+ Sbjct: 117 VSNSCSPGDPLVLERPPPRWSSN 139 >SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 V NSCSPGDPLV+ERPPPR S+ Sbjct: 184 VSNSCSPGDPLVLERPPPRWSSN 206 >SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 V NSCSPGDPLV+ERPPPR S+ Sbjct: 34 VSNSCSPGDPLVLERPPPRWSSN 56 >SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/31 (58%), Positives = 23/31 (74%) Frame = -2 Query: 99 LLTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 L++ + NSCSPGDPLV+ERPPPR S+ Sbjct: 8 LISANIKAGSNSCSPGDPLVLERPPPRWSSN 38 >SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1407 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 V NSCSPGDPLV+ERPPPR S+ Sbjct: 1066 VSNSCSPGDPLVLERPPPRWSSN 1088 >SB_14180| Best HMM Match : ERp29_N (HMM E-Value=3.4) Length = 153 Score = 44.0 bits (99), Expect = 1e-04 Identities = 24/39 (61%), Positives = 27/39 (69%), Gaps = 3/39 (7%) Frame = +2 Query: 8 LETPRGGGRSITSGSPGLQEFGTRVTSR---VKSGASLP 115 LE RGGGRS TSGSPGLQEF +T+R + GA LP Sbjct: 3 LELHRGGGRSRTSGSPGLQEFDVYLTTRRILYELGAPLP 41 >SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/24 (70%), Positives = 21/24 (87%) Frame = -2 Query: 78 LVPNSCSPGDPLVIERPPPRGVSS 7 ++ NSCSPGDPLV+ERPPPR S+ Sbjct: 14 VISNSCSPGDPLVLERPPPRWSSN 37 >SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) Length = 190 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -2 Query: 90 REVTLVPNSCSPGDPLVIERPPPRGVSS 7 R+ + NSCSPGDPLV+ERPPPR S+ Sbjct: 61 RKSSTTSNSCSPGDPLVLERPPPRWSSN 88 >SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 V NSCSPGDPLV+ERPPPR S+ Sbjct: 3 VSNSCSPGDPLVLERPPPRWSSN 25 >SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) Length = 680 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 V NSCSPGDPLV+ERPPPR S+ Sbjct: 214 VSNSCSPGDPLVLERPPPRWSSN 236 >SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/26 (65%), Positives = 21/26 (80%) Frame = -2 Query: 84 VTLVPNSCSPGDPLVIERPPPRGVSS 7 + + NSCSPGDPLV+ERPPPR S+ Sbjct: 16 IKITSNSCSPGDPLVLERPPPRWSSN 41 >SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 44.0 bits (99), Expect = 1e-04 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = -2 Query: 93 TREVTLVPNSCSPGDPLVIERPPPRGVSS 7 +REV NSCSPGDPLV+ERPPPR S+ Sbjct: 75 SREVA-TSNSCSPGDPLVLERPPPRWSSN 102 >SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 V NSCSPGDPLV+ERPPPR S+ Sbjct: 32 VSNSCSPGDPLVLERPPPRWSSN 54 >SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -2 Query: 78 LVPNSCSPGDPLVIERPPPRGVSS 7 L NSCSPGDPLV+ERPPPR S+ Sbjct: 5 LASNSCSPGDPLVLERPPPRWSSN 28 >SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) Length = 214 Score = 44.0 bits (99), Expect = 1e-04 Identities = 20/38 (52%), Positives = 25/38 (65%) Frame = -2 Query: 120 NGGREAPLLTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 + GR+A + NSCSPGDPLV+ERPPPR S+ Sbjct: 173 DAGRDAAAHEVQDLCKSNSCSPGDPLVLERPPPRWSSN 210 >SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 V NSCSPGDPLV+ERPPPR S+ Sbjct: 5 VSNSCSPGDPLVLERPPPRWSSN 27 >SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 V NSCSPGDPLV+ERPPPR S+ Sbjct: 3 VSNSCSPGDPLVLERPPPRWSSN 25 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 V NSCSPGDPLV+ERPPPR S+ Sbjct: 64 VSNSCSPGDPLVLERPPPRWSSN 86 >SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) Length = 923 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 84 VTLVPNSCSPGDPLVIERPPPRGVSS 7 V + NSCSPGDPLV+ERPPPR S+ Sbjct: 796 VAISSNSCSPGDPLVLERPPPRWSSN 821 >SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 V NSCSPGDPLV+ERPPPR S+ Sbjct: 4 VSNSCSPGDPLVLERPPPRWSSN 26 >SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 V NSCSPGDPLV+ERPPPR S+ Sbjct: 4 VSNSCSPGDPLVLERPPPRWSSN 26 >SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 V NSCSPGDPLV+ERPPPR S+ Sbjct: 11 VSNSCSPGDPLVLERPPPRWSSN 33 >SB_46791| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 44.0 bits (99), Expect = 1e-04 Identities = 21/30 (70%), Positives = 23/30 (76%), Gaps = 1/30 (3%) Frame = -2 Query: 93 TREVT-LVPNSCSPGDPLVIERPPPRGVSS 7 TRE T NSCSPGDPLV+ERPPPR S+ Sbjct: 18 TRESTPFGSNSCSPGDPLVLERPPPRWSSN 47 >SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 V NSCSPGDPLV+ERPPPR S+ Sbjct: 25 VSNSCSPGDPLVLERPPPRWSSN 47 >SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 V NSCSPGDPLV+ERPPPR S+ Sbjct: 15 VSNSCSPGDPLVLERPPPRWSSN 37 >SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -2 Query: 78 LVPNSCSPGDPLVIERPPPRGVSS 7 L NSCSPGDPLV+ERPPPR S+ Sbjct: 17 LASNSCSPGDPLVLERPPPRWSSN 40 >SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 44.0 bits (99), Expect = 1e-04 Identities = 21/33 (63%), Positives = 24/33 (72%) Frame = -2 Query: 105 APLLTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 AP L R + NSCSPGDPLV+ERPPPR S+ Sbjct: 20 APQLIRSLQR-SNSCSPGDPLVLERPPPRWSSN 51 >SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) Length = 1098 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/30 (60%), Positives = 23/30 (76%) Frame = -2 Query: 96 LTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 ++R + NSCSPGDPLV+ERPPPR S+ Sbjct: 967 VSRRKGWISNSCSPGDPLVLERPPPRWSSN 996 >SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 V NSCSPGDPLV+ERPPPR S+ Sbjct: 10 VSNSCSPGDPLVLERPPPRWSSN 32 >SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 V NSCSPGDPLV+ERPPPR S+ Sbjct: 31 VSNSCSPGDPLVLERPPPRWSSN 53 >SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 V NSCSPGDPLV+ERPPPR S+ Sbjct: 4 VSNSCSPGDPLVLERPPPRWSSN 26 >SB_38625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = -2 Query: 81 TLVPNSCSPGDPLVIERPPPRGVSS 7 T+ NSCSPGDPLV+ERPPPR S+ Sbjct: 44 TVPSNSCSPGDPLVLERPPPRWSSN 68 >SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 V NSCSPGDPLV+ERPPPR S+ Sbjct: 41 VSNSCSPGDPLVLERPPPRWSSN 63 >SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 V NSCSPGDPLV+ERPPPR S+ Sbjct: 15 VSNSCSPGDPLVLERPPPRWSSN 37 >SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 V NSCSPGDPLV+ERPPPR S+ Sbjct: 4 VSNSCSPGDPLVLERPPPRWSSN 26 >SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 V NSCSPGDPLV+ERPPPR S+ Sbjct: 6 VSNSCSPGDPLVLERPPPRWSSN 28 >SB_34241| Best HMM Match : RuvA_C (HMM E-Value=1.5) Length = 274 Score = 44.0 bits (99), Expect = 1e-04 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = -2 Query: 87 EVTLVPNSCSPGDPLVIERPPPRGVSS 7 EV NSCSPGDPLV+ERPPPR S+ Sbjct: 146 EVANSSNSCSPGDPLVLERPPPRWSSN 172 >SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/24 (70%), Positives = 21/24 (87%) Frame = -2 Query: 78 LVPNSCSPGDPLVIERPPPRGVSS 7 ++ NSCSPGDPLV+ERPPPR S+ Sbjct: 5 VISNSCSPGDPLVLERPPPRWSSN 28 >SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 V NSCSPGDPLV+ERPPPR S+ Sbjct: 15 VSNSCSPGDPLVLERPPPRWSSN 37 >SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -2 Query: 78 LVPNSCSPGDPLVIERPPPRGVSS 7 L NSCSPGDPLV+ERPPPR S+ Sbjct: 37 LTSNSCSPGDPLVLERPPPRWSSN 60 >SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 V NSCSPGDPLV+ERPPPR S+ Sbjct: 18 VSNSCSPGDPLVLERPPPRWSSN 40 >SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -2 Query: 78 LVPNSCSPGDPLVIERPPPRGVSS 7 L NSCSPGDPLV+ERPPPR S+ Sbjct: 20 LASNSCSPGDPLVLERPPPRWSSN 43 >SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 V NSCSPGDPLV+ERPPPR S+ Sbjct: 30 VSNSCSPGDPLVLERPPPRWSSN 52 >SB_27240| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 137 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 84 VTLVPNSCSPGDPLVIERPPPRGVSS 7 V+ NSCSPGDPLV+ERPPPR S+ Sbjct: 10 VSYTSNSCSPGDPLVLERPPPRWSSN 35 >SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 V NSCSPGDPLV+ERPPPR S+ Sbjct: 32 VSNSCSPGDPLVLERPPPRWSSN 54 >SB_22502| Best HMM Match : FtsL (HMM E-Value=0.0086) Length = 167 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -2 Query: 90 REVTLVPNSCSPGDPLVIERPPPRGVSS 7 R++ NSCSPGDPLV+ERPPPR S+ Sbjct: 38 RQLLNASNSCSPGDPLVLERPPPRWSSN 65 >SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -2 Query: 78 LVPNSCSPGDPLVIERPPPRGVSS 7 L NSCSPGDPLV+ERPPPR S+ Sbjct: 88 LTSNSCSPGDPLVLERPPPRWSSN 111 >SB_18776| Best HMM Match : DUF765 (HMM E-Value=4) Length = 134 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/30 (60%), Positives = 22/30 (73%) Frame = -2 Query: 96 LTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 L ++ NSCSPGDPLV+ERPPPR S+ Sbjct: 3 LVNVISKTSNSCSPGDPLVLERPPPRWSSN 32 >SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 V NSCSPGDPLV+ERPPPR S+ Sbjct: 8 VSNSCSPGDPLVLERPPPRWSSN 30 >SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 V NSCSPGDPLV+ERPPPR S+ Sbjct: 10 VSNSCSPGDPLVLERPPPRWSSN 32 >SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 V NSCSPGDPLV+ERPPPR S+ Sbjct: 18 VSNSCSPGDPLVLERPPPRWSSN 40 >SB_14019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/31 (58%), Positives = 23/31 (74%) Frame = -2 Query: 99 LLTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 L++ + NSCSPGDPLV+ERPPPR S+ Sbjct: 8 LISANILAGSNSCSPGDPLVLERPPPRWSSN 38 >SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/26 (65%), Positives = 21/26 (80%) Frame = -2 Query: 84 VTLVPNSCSPGDPLVIERPPPRGVSS 7 + + NSCSPGDPLV+ERPPPR S+ Sbjct: 18 IDIASNSCSPGDPLVLERPPPRWSSN 43 >SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 V NSCSPGDPLV+ERPPPR S+ Sbjct: 27 VSNSCSPGDPLVLERPPPRWSSN 49 >SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -2 Query: 78 LVPNSCSPGDPLVIERPPPRGVSS 7 L NSCSPGDPLV+ERPPPR S+ Sbjct: 7 LASNSCSPGDPLVLERPPPRWSSN 30 >SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) Length = 317 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 V NSCSPGDPLV+ERPPPR S+ Sbjct: 193 VSNSCSPGDPLVLERPPPRWSSN 215 >SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 44.0 bits (99), Expect = 1e-04 Identities = 20/41 (48%), Positives = 25/41 (60%) Frame = -2 Query: 129 RHFNGGREAPLLTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 R + G L + + NSCSPGDPLV+ERPPPR S+ Sbjct: 50 RRYQLGSRQDLNIIQKIKISNSCSPGDPLVLERPPPRWSSN 90 >SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 V NSCSPGDPLV+ERPPPR S+ Sbjct: 17 VSNSCSPGDPLVLERPPPRWSSN 39 >SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/24 (70%), Positives = 21/24 (87%) Frame = -2 Query: 78 LVPNSCSPGDPLVIERPPPRGVSS 7 ++ NSCSPGDPLV+ERPPPR S+ Sbjct: 25 VISNSCSPGDPLVLERPPPRWSSN 48 >SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) Length = 221 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -2 Query: 78 LVPNSCSPGDPLVIERPPPRGVSS 7 L NSCSPGDPLV+ERPPPR S+ Sbjct: 96 LASNSCSPGDPLVLERPPPRWSSN 119 >SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -2 Query: 78 LVPNSCSPGDPLVIERPPPRGVSS 7 L NSCSPGDPLV+ERPPPR S+ Sbjct: 4 LASNSCSPGDPLVLERPPPRWSSN 27 >SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/26 (65%), Positives = 21/26 (80%) Frame = -2 Query: 84 VTLVPNSCSPGDPLVIERPPPRGVSS 7 + + NSCSPGDPLV+ERPPPR S+ Sbjct: 7 IRYISNSCSPGDPLVLERPPPRWSSN 32 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 + NSCSPGDPLV+ERPPPR S+ Sbjct: 5 ISNSCSPGDPLVLERPPPRWSSN 27 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 + NSCSPGDPLV+ERPPPR S+ Sbjct: 261 ISNSCSPGDPLVLERPPPRWSSN 283 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/24 (70%), Positives = 21/24 (87%) Frame = -2 Query: 78 LVPNSCSPGDPLVIERPPPRGVSS 7 ++ NSCSPGDPLV+ERPPPR S+ Sbjct: 13 ILSNSCSPGDPLVLERPPPRWSSN 36 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 43.6 bits (98), Expect = 1e-04 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = -2 Query: 129 RHFNGGREAPLLTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 RHF G + L+ NSCSPGDPLV+ERPPPR S+ Sbjct: 12 RHFTGHAKNDALSS------NSCSPGDPLVLERPPPRWSSN 46 >SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 + NSCSPGDPLV+ERPPPR S+ Sbjct: 21 ISNSCSPGDPLVLERPPPRWSSN 43 >SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 43.6 bits (98), Expect = 1e-04 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -2 Query: 90 REVTLVPNSCSPGDPLVIERPPPRGVSS 7 R ++ NSCSPGDPLV+ERPPPR S+ Sbjct: 8 RITKVLSNSCSPGDPLVLERPPPRWSSN 35 >SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1887 Score = 43.6 bits (98), Expect = 1e-04 Identities = 19/26 (73%), Positives = 21/26 (80%) Frame = -2 Query: 84 VTLVPNSCSPGDPLVIERPPPRGVSS 7 V L NSCSPGDPLV+ERPPPR S+ Sbjct: 1018 VGLGSNSCSPGDPLVLERPPPRWSSN 1043 >SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/27 (62%), Positives = 22/27 (81%) Frame = -2 Query: 87 EVTLVPNSCSPGDPLVIERPPPRGVSS 7 ++ + NSCSPGDPLV+ERPPPR S+ Sbjct: 17 KLLITSNSCSPGDPLVLERPPPRWSSN 43 >SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 43.6 bits (98), Expect = 1e-04 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 84 VTLVPNSCSPGDPLVIERPPPRGVSS 7 V + NSCSPGDPLV+ERPPPR S+ Sbjct: 2 VQISSNSCSPGDPLVLERPPPRWSSN 27 >SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 + NSCSPGDPLV+ERPPPR S+ Sbjct: 9 ISNSCSPGDPLVLERPPPRWSSN 31 >SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 + NSCSPGDPLV+ERPPPR S+ Sbjct: 10 ISNSCSPGDPLVLERPPPRWSSN 32 >SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 + NSCSPGDPLV+ERPPPR S+ Sbjct: 3 ISNSCSPGDPLVLERPPPRWSSN 25 >SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) Length = 180 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/24 (70%), Positives = 21/24 (87%) Frame = -2 Query: 78 LVPNSCSPGDPLVIERPPPRGVSS 7 ++ NSCSPGDPLV+ERPPPR S+ Sbjct: 55 ILSNSCSPGDPLVLERPPPRWSSN 78 >SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 + NSCSPGDPLV+ERPPPR S+ Sbjct: 13 ISNSCSPGDPLVLERPPPRWSSN 35 >SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 + NSCSPGDPLV+ERPPPR S+ Sbjct: 4 ISNSCSPGDPLVLERPPPRWSSN 26 >SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) Length = 280 Score = 43.6 bits (98), Expect = 1e-04 Identities = 21/43 (48%), Positives = 25/43 (58%) Frame = -2 Query: 135 ESRHFNGGREAPLLTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 ES ++ L V NSCSPGDPLV+ERPPPR S+ Sbjct: 136 ESPQSKANGDSFLCEDAVAFPSNSCSPGDPLVLERPPPRWSSN 178 >SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) Length = 176 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 + NSCSPGDPLV+ERPPPR S+ Sbjct: 52 ISNSCSPGDPLVLERPPPRWSSN 74 >SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 + NSCSPGDPLV+ERPPPR S+ Sbjct: 51 ISNSCSPGDPLVLERPPPRWSSN 73 >SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) Length = 128 Score = 43.6 bits (98), Expect = 1e-04 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = -2 Query: 81 TLVPNSCSPGDPLVIERPPPRGVSS 7 +L NSCSPGDPLV+ERPPPR S+ Sbjct: 3 SLSSNSCSPGDPLVLERPPPRWSSN 27 >SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 43.6 bits (98), Expect = 1e-04 Identities = 18/26 (69%), Positives = 20/26 (76%) Frame = -2 Query: 84 VTLVPNSCSPGDPLVIERPPPRGVSS 7 V NSCSPGDPLV+ERPPPR S+ Sbjct: 5 VIFTSNSCSPGDPLVLERPPPRWSSN 30 >SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/26 (65%), Positives = 22/26 (84%) Frame = -2 Query: 84 VTLVPNSCSPGDPLVIERPPPRGVSS 7 + ++ NSCSPGDPLV+ERPPPR S+ Sbjct: 31 IGVLSNSCSPGDPLVLERPPPRWSSN 56 >SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) Length = 558 Score = 43.6 bits (98), Expect = 1e-04 Identities = 26/61 (42%), Positives = 34/61 (55%), Gaps = 3/61 (4%) Frame = -2 Query: 180 RQQ*PGLTMERG*LTESRHFNGGREAPLLTREVT---LVPNSCSPGDPLVIERPPPRGVS 10 +QQ ++ R L ES+ + LL E+ NSCSPGDPLV+ERPPPR S Sbjct: 441 QQQHSEISRLRAELKESQEQHRYEVTRLLQGEIASGQTTSNSCSPGDPLVLERPPPRWSS 500 Query: 9 S 7 + Sbjct: 501 N 501 >SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/26 (65%), Positives = 21/26 (80%) Frame = -2 Query: 84 VTLVPNSCSPGDPLVIERPPPRGVSS 7 + + NSCSPGDPLV+ERPPPR S+ Sbjct: 1 MVITSNSCSPGDPLVLERPPPRWSSN 26 >SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 43.6 bits (98), Expect = 1e-04 Identities = 18/32 (56%), Positives = 22/32 (68%) Frame = -2 Query: 102 PLLTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 P + + NSCSPGDPLV+ERPPPR S+ Sbjct: 2 PSIREAQPVTSNSCSPGDPLVLERPPPRWSSN 33 >SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 + NSCSPGDPLV+ERPPPR S+ Sbjct: 21 ISNSCSPGDPLVLERPPPRWSSN 43 >SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 + NSCSPGDPLV+ERPPPR S+ Sbjct: 152 ISNSCSPGDPLVLERPPPRWSSN 174 >SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 311 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/27 (62%), Positives = 22/27 (81%) Frame = -2 Query: 87 EVTLVPNSCSPGDPLVIERPPPRGVSS 7 ++ + NSCSPGDPLV+ERPPPR S+ Sbjct: 183 DLVIQSNSCSPGDPLVLERPPPRWSSN 209 >SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 + NSCSPGDPLV+ERPPPR S+ Sbjct: 4 ISNSCSPGDPLVLERPPPRWSSN 26 >SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 + NSCSPGDPLV+ERPPPR S+ Sbjct: 47 ISNSCSPGDPLVLERPPPRWSSN 69 >SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 + NSCSPGDPLV+ERPPPR S+ Sbjct: 7 ISNSCSPGDPLVLERPPPRWSSN 29 >SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 + NSCSPGDPLV+ERPPPR S+ Sbjct: 4 ISNSCSPGDPLVLERPPPRWSSN 26 >SB_51374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 43.6 bits (98), Expect = 1e-04 Identities = 19/30 (63%), Positives = 22/30 (73%) Frame = -2 Query: 96 LTREVTLVPNSCSPGDPLVIERPPPRGVSS 7 L +V NSCSPGDPLV+ERPPPR S+ Sbjct: 2 LLNQVIQGSNSCSPGDPLVLERPPPRWSSN 31 >SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 + NSCSPGDPLV+ERPPPR S+ Sbjct: 32 ISNSCSPGDPLVLERPPPRWSSN 54 >SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/26 (65%), Positives = 21/26 (80%) Frame = -2 Query: 84 VTLVPNSCSPGDPLVIERPPPRGVSS 7 + + NSCSPGDPLV+ERPPPR S+ Sbjct: 3 ILFLSNSCSPGDPLVLERPPPRWSSN 28 >SB_48900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 43.6 bits (98), Expect = 1e-04 Identities = 18/26 (69%), Positives = 22/26 (84%) Frame = -2 Query: 84 VTLVPNSCSPGDPLVIERPPPRGVSS 7 +T + NSCSPGDPLV+ERPPPR S+ Sbjct: 35 LTGLSNSCSPGDPLVLERPPPRWSSN 60 >SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/26 (65%), Positives = 22/26 (84%) Frame = -2 Query: 84 VTLVPNSCSPGDPLVIERPPPRGVSS 7 + ++ NSCSPGDPLV+ERPPPR S+ Sbjct: 21 IHVLSNSCSPGDPLVLERPPPRWSSN 46 >SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 + NSCSPGDPLV+ERPPPR S+ Sbjct: 18 ISNSCSPGDPLVLERPPPRWSSN 40 >SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 + NSCSPGDPLV+ERPPPR S+ Sbjct: 32 ISNSCSPGDPLVLERPPPRWSSN 54 >SB_44611| Best HMM Match : DUF765 (HMM E-Value=2.6) Length = 159 Score = 43.6 bits (98), Expect = 1e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = -2 Query: 81 TLVPNSCSPGDPLVIERPPPRGVSS 7 T NSCSPGDPLV+ERPPPR S+ Sbjct: 33 TKTSNSCSPGDPLVLERPPPRWSSN 57 >SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -2 Query: 75 VPNSCSPGDPLVIERPPPRGVSS 7 + NSCSPGDPLV+ERPPPR S+ Sbjct: 6 ISNSCSPGDPLVLERPPPRWSSN 28 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,388,836 Number of Sequences: 59808 Number of extensions: 581354 Number of successful extensions: 3944 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3740 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3942 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1669334250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -