BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31197 (323 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29515| Best HMM Match : TolA (HMM E-Value=0.031) 35 0.017 SB_36946| Best HMM Match : ResIII (HMM E-Value=0.47) 33 0.070 SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.093 SB_28981| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.093 SB_5831| Best HMM Match : TolA (HMM E-Value=0.0037) 31 0.16 SB_42146| Best HMM Match : GYF (HMM E-Value=5.7e-15) 31 0.28 SB_30819| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.28 SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) 31 0.28 SB_35941| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.38 SB_48451| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.38 SB_58977| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.66 SB_55427| Best HMM Match : E-MAP-115 (HMM E-Value=0.077) 29 0.66 SB_49860| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.66 SB_1624| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.66 SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) 29 0.66 SB_9788| Best HMM Match : Seryl_tRNA_N (HMM E-Value=4.9) 29 0.66 SB_58981| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.87 SB_3226| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=0.021) 29 0.87 SB_1939| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.87 SB_28090| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.87 SB_15350| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.87 SB_15709| Best HMM Match : CAP_GLY (HMM E-Value=0) 29 1.1 SB_2606| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.1 SB_28495| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.5 SB_38433| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.5 SB_57924| Best HMM Match : PG_binding_1 (HMM E-Value=3.5) 28 2.0 SB_51317| Best HMM Match : E-MAP-115 (HMM E-Value=0.58) 28 2.0 SB_46755| Best HMM Match : zf-C2H2 (HMM E-Value=1.09301e-43) 28 2.0 SB_14692| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.0 SB_5750| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.0 SB_2279| Best HMM Match : PG_binding_1 (HMM E-Value=3.5) 28 2.0 SB_47663| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.6 SB_29786| Best HMM Match : I-set (HMM E-Value=0) 27 2.6 SB_19577| Best HMM Match : SERTA (HMM E-Value=7.8e-10) 27 2.6 SB_49663| Best HMM Match : TolA (HMM E-Value=0.059) 27 2.6 SB_22224| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.6 SB_48517| Best HMM Match : DUF866 (HMM E-Value=1.9) 27 3.5 SB_34458| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_26233| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_21439| Best HMM Match : LicD (HMM E-Value=4.5e-08) 27 3.5 SB_17568| Best HMM Match : Ldl_recept_a (HMM E-Value=0.04) 27 3.5 SB_47024| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.6 SB_7313| Best HMM Match : IQ (HMM E-Value=0.00059) 27 4.6 SB_53672| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.6 SB_36059| Best HMM Match : TolA (HMM E-Value=0.1) 27 4.6 SB_31228| Best HMM Match : EMP24_GP25L (HMM E-Value=0.22) 27 4.6 SB_18786| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.6 SB_49662| Best HMM Match : Bromodomain (HMM E-Value=9.8e-38) 26 6.1 SB_49384| Best HMM Match : GNT-I (HMM E-Value=0) 26 6.1 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 26 6.1 SB_37864| Best HMM Match : Extensin_2 (HMM E-Value=0.064) 26 6.1 SB_24800| Best HMM Match : DUF866 (HMM E-Value=4) 26 6.1 SB_24366| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 6.1 SB_46756| Best HMM Match : zf-C2H2 (HMM E-Value=4.60046e-42) 26 6.1 SB_44274| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 6.1 SB_40403| Best HMM Match : Vicilin_N (HMM E-Value=0.012) 26 6.1 SB_39563| Best HMM Match : Ctr (HMM E-Value=0.39) 26 6.1 SB_8304| Best HMM Match : PLAT (HMM E-Value=0) 26 6.1 SB_7408| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 6.1 SB_2860| Best HMM Match : IncA (HMM E-Value=0.41) 26 6.1 SB_53319| Best HMM Match : zf-CW (HMM E-Value=7.7e-17) 26 8.1 SB_45896| Best HMM Match : ApoC-I (HMM E-Value=4) 26 8.1 SB_45045| Best HMM Match : Kinesin (HMM E-Value=0) 26 8.1 SB_30234| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_30003| Best HMM Match : DUF906 (HMM E-Value=0) 26 8.1 SB_27235| Best HMM Match : ApoC-I (HMM E-Value=4) 26 8.1 SB_24613| Best HMM Match : Ctr (HMM E-Value=0.73) 26 8.1 SB_22653| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_21999| Best HMM Match : ApoC-I (HMM E-Value=4) 26 8.1 SB_14000| Best HMM Match : DUF1213 (HMM E-Value=0.71) 26 8.1 SB_3246| Best HMM Match : ApoC-I (HMM E-Value=4) 26 8.1 SB_59533| Best HMM Match : ApoC-I (HMM E-Value=4) 26 8.1 SB_52528| Best HMM Match : HLH (HMM E-Value=3.9e-18) 26 8.1 SB_44773| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_31678| Best HMM Match : ApoC-I (HMM E-Value=4) 26 8.1 SB_11764| Best HMM Match : DSHCT (HMM E-Value=1.9e-27) 26 8.1 >SB_29515| Best HMM Match : TolA (HMM E-Value=0.031) Length = 592 Score = 34.7 bits (76), Expect = 0.017 Identities = 21/75 (28%), Positives = 40/75 (53%) Frame = +1 Query: 1 RVREIEYKKQRDIEEKRQRLEEAEKKRQAMLQAMKGCQQGPGPNFTIQKKSENFGLSNAQ 180 R +E+E K++ E KR++LEEAE+ + L+A + ++ ++++E + Sbjct: 340 RRQEVERKRREREEAKRKQLEEAERLERVRLEAEEEMKRREEERRKKREEAERERKRKEE 399 Query: 181 LERNKTKGAAGRGEK 225 ERN+ K R E+ Sbjct: 400 EERNREKQEKARLER 414 >SB_36946| Best HMM Match : ResIII (HMM E-Value=0.47) Length = 979 Score = 32.7 bits (71), Expect = 0.070 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = -2 Query: 322 TMHSQSSWPFCRSLSNEETLDGQRLN 245 T+HS S+ P C+SL N + LD RLN Sbjct: 792 TIHSASAVPACQSLKNYKKLDSSRLN 817 >SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 903 Score = 32.3 bits (70), Expect = 0.093 Identities = 14/26 (53%), Positives = 21/26 (80%) Frame = +1 Query: 7 REIEYKKQRDIEEKRQRLEEAEKKRQ 84 RE E +KQR+ EE++Q+ +E EKKR+ Sbjct: 476 REEEERKQREEEERKQKEKEEEKKRK 501 Score = 27.9 bits (59), Expect = 2.0 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = +1 Query: 1 RVREIEYKKQRDIEEKRQRLEEAEKKRQ 84 R RE E +KQR+ EE+++R EE K+R+ Sbjct: 459 RKREEEERKQRE-EEEKKREEEERKQRE 485 Score = 27.5 bits (58), Expect = 2.6 Identities = 18/65 (27%), Positives = 34/65 (52%) Frame = +1 Query: 7 REIEYKKQRDIEEKRQRLEEAEKKRQAMLQAMKGCQQGPGPNFTIQKKSENFGLSNAQLE 186 R E +++R+ EE++QR EE EKKR+ + + ++ +KK + + + E Sbjct: 453 RREEEERKREEEERKQR-EEEEKKREEEERKQREEEERKQKEKEEEKKRKEEERKHKEEE 511 Query: 187 RNKTK 201 KT+ Sbjct: 512 EKKTE 516 Score = 26.2 bits (55), Expect = 6.1 Identities = 11/28 (39%), Positives = 20/28 (71%) Frame = +1 Query: 1 RVREIEYKKQRDIEEKRQRLEEAEKKRQ 84 R + E +K+R+ EE++QR EE K+++ Sbjct: 466 RKQREEEEKKREEEERKQREEEERKQKE 493 >SB_28981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 655 Score = 32.3 bits (70), Expect = 0.093 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 2/32 (6%) Frame = +1 Query: 16 EYKKQRD--IEEKRQRLEEAEKKRQAMLQAMK 105 E +K +D +EE+R+RLE EK+RQA QAM+ Sbjct: 310 EKQKLQDKILEEERKRLENLEKERQAAQQAMQ 341 >SB_5831| Best HMM Match : TolA (HMM E-Value=0.0037) Length = 703 Score = 31.5 bits (68), Expect = 0.16 Identities = 25/103 (24%), Positives = 50/103 (48%), Gaps = 3/103 (2%) Frame = +1 Query: 4 VREIEYKKQRDIEEKRQRLEEAEKKRQAMLQAMKGCQQGPGPNFTIQKKSENFGLSNAQL 183 V + +K+R +EE++ RL+E E++R+ + K + G P+ +++ S G ++ Sbjct: 587 VHAVADQKERLLEEEKVRLKEEEEERKKQEERKKAKEAGRRPS-PVKRVSRIPGNDQPRV 645 Query: 184 ERNKT---KGAAGRGEKNLPVHSH*AADHRGSLRSTNSDRKAR 303 R + K + G+KN S + R +++ S AR Sbjct: 646 SREDSRTRKSSRDNGDKNQEGRSRTLSRGREPTKTSLSKSPAR 688 Score = 29.1 bits (62), Expect = 0.87 Identities = 12/26 (46%), Positives = 21/26 (80%) Frame = +1 Query: 7 REIEYKKQRDIEEKRQRLEEAEKKRQ 84 +++E ++ +EE+R+R EEAEKKR+ Sbjct: 242 KKLEEEEANLMEEERKRKEEAEKKRE 267 >SB_42146| Best HMM Match : GYF (HMM E-Value=5.7e-15) Length = 924 Score = 30.7 bits (66), Expect = 0.28 Identities = 16/52 (30%), Positives = 31/52 (59%) Frame = +1 Query: 1 RVREIEYKKQRDIEEKRQRLEEAEKKRQAMLQAMKGCQQGPGPNFTIQKKSE 156 R +E ++QR+ EE+R++ EEAE++R+ + K Q+ +QK+ + Sbjct: 623 RQQEQMLQRQREEEERRRQQEEAERQRREQEEVFKQ-QEQQRQQLELQKRQQ 673 >SB_30819| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 30.7 bits (66), Expect = 0.28 Identities = 14/27 (51%), Positives = 20/27 (74%) Frame = +1 Query: 1 RVREIEYKKQRDIEEKRQRLEEAEKKR 81 R REIE +Q +EE++QRL++ E KR Sbjct: 12 REREIERHRQALLEEEKQRLKDEEDKR 38 >SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) Length = 1683 Score = 30.7 bits (66), Expect = 0.28 Identities = 14/31 (45%), Positives = 21/31 (67%) Frame = +1 Query: 1 RVREIEYKKQRDIEEKRQRLEEAEKKRQAML 93 R R + +K R + ++QRL E E+KRQAM+ Sbjct: 652 RKRREKEEKDRQFQLEKQRLAEEEQKRQAMI 682 Score = 29.1 bits (62), Expect = 0.87 Identities = 15/35 (42%), Positives = 24/35 (68%) Frame = +1 Query: 1 RVREIEYKKQRDIEEKRQRLEEAEKKRQAMLQAMK 105 R +E E +K+RD EE+++R E+ EK RQ L+ + Sbjct: 637 RRKEEEEQKKRDEEERKRR-EKEEKDRQFQLEKQR 670 Score = 27.9 bits (59), Expect = 2.0 Identities = 11/32 (34%), Positives = 24/32 (75%) Frame = +1 Query: 10 EIEYKKQRDIEEKRQRLEEAEKKRQAMLQAMK 105 E+E +K+R+ EE++++ EE E+KR+ ++ + Sbjct: 607 ELE-RKRREEEERKRKQEEEERKRKMQMELQR 637 >SB_35941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 414 Score = 30.3 bits (65), Expect = 0.38 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -2 Query: 322 TMHSQSSWPFCRSLSNEETLDGQRLN 245 T+HS + P C+SL N + LD RLN Sbjct: 95 TIHSALAVPACQSLKNYKKLDSSRLN 120 >SB_48451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2851 Score = 30.3 bits (65), Expect = 0.38 Identities = 19/44 (43%), Positives = 24/44 (54%) Frame = +1 Query: 22 KKQRDIEEKRQRLEEAEKKRQAMLQAMKGCQQGPGPNFTIQKKS 153 +KQR+ EEK++R E EK Q K Q G P FT Q +S Sbjct: 1589 EKQREEEEKKRRTE--EKAAQRGDAKFKKNQPGKAPRFTKQHQS 1630 >SB_58977| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 29.5 bits (63), Expect = 0.66 Identities = 14/42 (33%), Positives = 29/42 (69%), Gaps = 1/42 (2%) Frame = +1 Query: 22 KKQRDIEEKRQRLEEAE-KKRQAMLQAMKGCQQGPGPNFTIQ 144 +++R+ +EK+Q+ EEAE +K+QA+L+ ++ + F I+ Sbjct: 57 RRRREEQEKKQKEEEAERRKKQAILEKLEVIKMATNNLFIIK 98 >SB_55427| Best HMM Match : E-MAP-115 (HMM E-Value=0.077) Length = 599 Score = 29.5 bits (63), Expect = 0.66 Identities = 16/36 (44%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = +1 Query: 1 RVREIEYKKQRDIEEKRQRLE-EAEKKRQAMLQAMK 105 R +E K+R EE+RQR + EAE++RQA L+ + Sbjct: 119 REKEEREAKERAEEERRQRAKMEAEQRRQAELEKQR 154 >SB_49860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 362 Score = 29.5 bits (63), Expect = 0.66 Identities = 14/35 (40%), Positives = 23/35 (65%) Frame = +1 Query: 1 RVREIEYKKQRDIEEKRQRLEEAEKKRQAMLQAMK 105 R RE E + R IEEK+++LEE E+ ++ + + K Sbjct: 279 RKREKELEMLRQIEEKKRKLEEEERIKEEVEKQKK 313 >SB_1624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 427 Score = 29.5 bits (63), Expect = 0.66 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +1 Query: 4 VREIEYKKQRDIEEKRQRLEEAEKKRQAMLQAMKGCQQ 117 ++EI Y +Q+D +E + E K A+ Q M+GC++ Sbjct: 308 IQEITYGRQKDSQESTETNIENANKDIAVEQGMEGCKK 345 >SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) Length = 442 Score = 29.5 bits (63), Expect = 0.66 Identities = 14/43 (32%), Positives = 26/43 (60%) Frame = +1 Query: 1 RVREIEYKKQRDIEEKRQRLEEAEKKRQAMLQAMKGCQQGPGP 129 ++RE+E K Q D EE+ ++ E+ ++ +A +AM+ P P Sbjct: 182 QIRELETKLQ-DAEERAEKAEQKVQELEAQAEAMEAVLAFPSP 223 >SB_9788| Best HMM Match : Seryl_tRNA_N (HMM E-Value=4.9) Length = 149 Score = 29.5 bits (63), Expect = 0.66 Identities = 15/70 (21%), Positives = 34/70 (48%), Gaps = 3/70 (4%) Frame = +1 Query: 1 RVREIEYKKQRDIEEKRQRLEEAEKKRQAMLQAMKGCQQGPGPNFT---IQKKSENFGLS 171 R+ EYK+ + ++++R+ L ++KK++ +G P + +++K E Sbjct: 61 RINNAEYKESQAVKKRRKLLRGSKKKKKKGRNTKEGGPPSANPGYAPACVREKKEEGAKE 120 Query: 172 NAQLERNKTK 201 A+ E+ K Sbjct: 121 EAKREKKLEK 130 >SB_58981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 794 Score = 29.1 bits (62), Expect = 0.87 Identities = 20/75 (26%), Positives = 37/75 (49%) Frame = +1 Query: 1 RVREIEYKKQRDIEEKRQRLEEAEKKRQAMLQAMKGCQQGPGPNFTIQKKSENFGLSNAQ 180 R RE E +++R+ E +R+R E E+KR A + + +G N K + Sbjct: 250 RERERERERERERERERERERERERKRYACVS--ETSTRGEPSNLNGSDKCIDLFGDLPP 307 Query: 181 LERNKTKGAAGRGEK 225 LE ++++G + E+ Sbjct: 308 LESSESRGEKRKAEE 322 >SB_3226| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=0.021) Length = 1217 Score = 29.1 bits (62), Expect = 0.87 Identities = 13/25 (52%), Positives = 20/25 (80%) Frame = +1 Query: 16 EYKKQRDIEEKRQRLEEAEKKRQAM 90 E ++QR+I+ +RQ L++ E KRQAM Sbjct: 561 EERRQREIQRRRQELQDIE-KRQAM 584 >SB_1939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1646 Score = 29.1 bits (62), Expect = 0.87 Identities = 13/37 (35%), Positives = 24/37 (64%) Frame = +1 Query: 7 REIEYKKQRDIEEKRQRLEEAEKKRQAMLQAMKGCQQ 117 +++E +KQ+ +EE+R R + E+KR+ Q + QQ Sbjct: 161 KQLEVEKQKRLEEERIRSQNEERKRREREQKEREKQQ 197 Score = 27.1 bits (57), Expect = 3.5 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +1 Query: 7 REIEYKKQRDIEEKRQRLEEAEKKRQ 84 RE + K + EE+R+R +E EKKR+ Sbjct: 193 REKQQKLDMEKEERRRRQQEEEKKRR 218 >SB_28090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 222 Score = 29.1 bits (62), Expect = 0.87 Identities = 13/26 (50%), Positives = 20/26 (76%) Frame = +1 Query: 13 IEYKKQRDIEEKRQRLEEAEKKRQAM 90 IE ++QR +EEK+++ +E KK QAM Sbjct: 78 IESEEQRKVEEKQEKEKEEFKKLQAM 103 >SB_15350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1126 Score = 29.1 bits (62), Expect = 0.87 Identities = 13/33 (39%), Positives = 25/33 (75%) Frame = +1 Query: 1 RVREIEYKKQRDIEEKRQRLEEAEKKRQAMLQA 99 R+ ++E ++Q+ +EE++++ EE E KR A L+A Sbjct: 771 RMEQLEIQRQKKVEEQKKKREEKE-KRVAELRA 802 Score = 26.2 bits (55), Expect = 6.1 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = +1 Query: 1 RVREIEYKKQRDIEEKRQRLEEAEKKRQAMLQAMK 105 RV E+ ++QR++ EK+++L E +K + + K Sbjct: 796 RVAELRAERQRELMEKKKQLLEKDKLISTLTEKAK 830 >SB_15709| Best HMM Match : CAP_GLY (HMM E-Value=0) Length = 729 Score = 28.7 bits (61), Expect = 1.1 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +1 Query: 7 REIEYKKQRDIEEKRQRLEEAEKKRQAMLQAMK 105 REI D+EEK + LEEA+ + +A+ MK Sbjct: 513 REITDTVSTDLEEKAKELEEAKSENEAISGKMK 545 >SB_2606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1352 Score = 28.7 bits (61), Expect = 1.1 Identities = 10/28 (35%), Positives = 21/28 (75%) Frame = +1 Query: 22 KKQRDIEEKRQRLEEAEKKRQAMLQAMK 105 +++RD+E KRQ + E +++ + MLQ ++ Sbjct: 909 EQERDLERKRQEIAEHKRQEREMLQKLE 936 >SB_28495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6753 Score = 28.3 bits (60), Expect = 1.5 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -2 Query: 322 TMHSQSSWPFCRSLSNEETLDGQRLN 245 T+HS + P C+SL N + L+ RLN Sbjct: 6678 TIHSALAVPACQSLKNYKKLNSSRLN 6703 >SB_38433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 28.3 bits (60), Expect = 1.5 Identities = 18/39 (46%), Positives = 24/39 (61%), Gaps = 2/39 (5%) Frame = +1 Query: 7 REIEYKKQRDIEEKRQRLEEAEKKR--QAMLQAMKGCQQ 117 RE E K QR EKRQ+ +E EK+R +A L +G Q+ Sbjct: 53 REEEKKSQR---EKRQKEKEEEKRRKEEAALSTWRGTQE 88 >SB_57924| Best HMM Match : PG_binding_1 (HMM E-Value=3.5) Length = 581 Score = 27.9 bits (59), Expect = 2.0 Identities = 15/41 (36%), Positives = 27/41 (65%) Frame = +1 Query: 1 RVREIEYKKQRDIEEKRQRLEEAEKKRQAMLQAMKGCQQGP 123 R+ EYK +RDI++KR+++ ++KR+ + K Q+GP Sbjct: 538 RIYGAEYK-ERDIQKKRRKVLRGQRKRK---EDKKQQQEGP 574 >SB_51317| Best HMM Match : E-MAP-115 (HMM E-Value=0.58) Length = 696 Score = 27.9 bits (59), Expect = 2.0 Identities = 10/33 (30%), Positives = 21/33 (63%) Frame = +1 Query: 7 REIEYKKQRDIEEKRQRLEEAEKKRQAMLQAMK 105 + + +Q+D EEK +RL E + +R+ + ++K Sbjct: 550 KRLSLHQQKDFEEKIRRLTERDSQRKGQVDSLK 582 >SB_46755| Best HMM Match : zf-C2H2 (HMM E-Value=1.09301e-43) Length = 1806 Score = 27.9 bits (59), Expect = 2.0 Identities = 19/66 (28%), Positives = 31/66 (46%) Frame = +1 Query: 40 EEKRQRLEEAEKKRQAMLQAMKGCQQGPGPNFTIQKKSENFGLSNAQLERNKTKGAAGRG 219 EE+RQ+ EEA K+R+ L + + +K E G + + ++ TKG Sbjct: 1344 EERRQKREEARKRREEKLAKKESSKSS-----NKRKSKERSGNPSFKRIKSTTKGRETEV 1398 Query: 220 EKNLPV 237 K+ PV Sbjct: 1399 TKDSPV 1404 >SB_14692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 239 Score = 27.9 bits (59), Expect = 2.0 Identities = 15/41 (36%), Positives = 27/41 (65%) Frame = +1 Query: 1 RVREIEYKKQRDIEEKRQRLEEAEKKRQAMLQAMKGCQQGP 123 R+ EYK +RDI++KR+++ ++KR+ + K Q+GP Sbjct: 196 RIYGAEYK-ERDIQKKRRKVLRGQRKRK---EDKKQQQEGP 232 >SB_5750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 27.9 bits (59), Expect = 2.0 Identities = 15/41 (36%), Positives = 27/41 (65%) Frame = +1 Query: 1 RVREIEYKKQRDIEEKRQRLEEAEKKRQAMLQAMKGCQQGP 123 R+ EYK +RDI++KR+++ ++KR+ + K Q+GP Sbjct: 237 RIYGAEYK-ERDIQKKRRKVLRGQRKRK---EDKKQQQEGP 273 >SB_2279| Best HMM Match : PG_binding_1 (HMM E-Value=3.5) Length = 351 Score = 27.9 bits (59), Expect = 2.0 Identities = 15/41 (36%), Positives = 27/41 (65%) Frame = +1 Query: 1 RVREIEYKKQRDIEEKRQRLEEAEKKRQAMLQAMKGCQQGP 123 R+ EYK +RDI++KR+++ ++KR+ + K Q+GP Sbjct: 308 RIYGAEYK-ERDIQKKRRKVLRGQRKRK---EDKKQQQEGP 344 >SB_47663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1409 Score = 27.5 bits (58), Expect = 2.6 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +3 Query: 147 EERKLRFEQCPAGAQQDQGSSWKRRKKSPCS 239 +E K + + CPA ++ S+W+R P S Sbjct: 617 QEEKCQTKACPANRSGNRSSNWRRHLHPPSS 647 >SB_29786| Best HMM Match : I-set (HMM E-Value=0) Length = 6300 Score = 27.5 bits (58), Expect = 2.6 Identities = 13/43 (30%), Positives = 26/43 (60%), Gaps = 2/43 (4%) Frame = +1 Query: 1 RVREIEYKKQRDIEEKRQRLEEAE--KKRQAMLQAMKGCQQGP 123 +V E++ KK++ +E + Q LEE K+++ + A K ++ P Sbjct: 5196 KVEEVKPKKEKPMEREAQHLEEKPLLKEKELPVSAEKAIEEKP 5238 >SB_19577| Best HMM Match : SERTA (HMM E-Value=7.8e-10) Length = 543 Score = 27.5 bits (58), Expect = 2.6 Identities = 16/47 (34%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = +2 Query: 113 SKDRDPTSPSKRRAKTSV*AMPSWSATRPRE-QLEEEKKISLFIRIK 250 +K RD S KRRA S P W A + E + + L R K Sbjct: 136 AKQRDTASAGKRRASASTATQPVWLAVEEDSINILEGESLRLMCRYK 182 >SB_49663| Best HMM Match : TolA (HMM E-Value=0.059) Length = 591 Score = 27.5 bits (58), Expect = 2.6 Identities = 16/49 (32%), Positives = 25/49 (51%) Frame = +1 Query: 10 EIEYKKQRDIEEKRQRLEEAEKKRQAMLQAMKGCQQGPGPNFTIQKKSE 156 E E +++ D E KR+ EEAE+ R + K Q+G +K+ E Sbjct: 460 EEENRRKADEERKRKEQEEAERNRVVQEEKRKIEQEGKQRKKESRKQEE 508 Score = 26.2 bits (55), Expect = 6.1 Identities = 17/69 (24%), Positives = 36/69 (52%), Gaps = 2/69 (2%) Frame = +1 Query: 1 RVREIEYKKQ--RDIEEKRQRLEEAEKKRQAMLQAMKGCQQGPGPNFTIQKKSENFGLSN 174 RV E++ K Q + IEE+ Q+ +EAE+K+ ++ + ++ +K++E + Sbjct: 304 RVEEMQRKTQEKKRIEEEEQKRKEAEEKKAKEIEQRRMEEEIKKEEEKKRKEAEEKRVKE 363 Query: 175 AQLERNKTK 201 Q+ K + Sbjct: 364 EQIRLEKER 372 >SB_22224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1106 Score = 27.5 bits (58), Expect = 2.6 Identities = 12/28 (42%), Positives = 21/28 (75%) Frame = +1 Query: 1 RVREIEYKKQRDIEEKRQRLEEAEKKRQ 84 R RE++ KK+RD E+KR++ EE ++ + Sbjct: 995 RERELQRKKERD-EQKRKKEEEKREREE 1021 >SB_48517| Best HMM Match : DUF866 (HMM E-Value=1.9) Length = 434 Score = 27.1 bits (57), Expect = 3.5 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = +1 Query: 1 RVREIEYKKQRDIEEKRQRLEEAEKKRQAMLQAMKGCQQGPG 126 RVR EYK + + KR+ L KK++ + +G PG Sbjct: 391 RVRLAEYKSKEASKRKRKVLRGKRKKKEDKKKQAEGSLYDPG 432 >SB_34458| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1318 Score = 27.1 bits (57), Expect = 3.5 Identities = 18/65 (27%), Positives = 31/65 (47%) Frame = +1 Query: 1 RVREIEYKKQRDIEEKRQRLEEAEKKRQAMLQAMKGCQQGPGPNFTIQKKSENFGLSNAQ 180 R +E+E + +D+ EKR R + + +L A + CQ + +QK+ F + Sbjct: 1027 RTQEVEPQWMKDLSEKR-RKGQGRRFSAEILSADEQCQPTLSRDDEVQKEVPGFLKEFEK 1085 Query: 181 LERNK 195 RNK Sbjct: 1086 KRRNK 1090 >SB_26233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 463 Score = 27.1 bits (57), Expect = 3.5 Identities = 18/67 (26%), Positives = 34/67 (50%) Frame = +1 Query: 1 RVREIEYKKQRDIEEKRQRLEEAEKKRQAMLQAMKGCQQGPGPNFTIQKKSENFGLSNAQ 180 R +E E +K+R +EK ++ E EK++Q + + +Q +K+ E L + Sbjct: 327 REKEKEREKERIQQEKEKQKERREKEKQKHQEKKEKERQREKEKLEKEKQKE---LERKE 383 Query: 181 LERNKTK 201 L+R K + Sbjct: 384 LQRQKER 390 >SB_21439| Best HMM Match : LicD (HMM E-Value=4.5e-08) Length = 362 Score = 27.1 bits (57), Expect = 3.5 Identities = 17/57 (29%), Positives = 26/57 (45%), Gaps = 1/57 (1%) Frame = -3 Query: 303 PGLSVGVCR-TKRPSMVSGLMRMNREIFFSSSSCSLGLVALQLGIAQTEVFALLLDG 136 P + G R + +M+S LMR R +F C L + + LG +T L+ G Sbjct: 28 PNANAGKGRLVEEENMISNLMRKQRVLFLCLLLCILLVTFINLGALKTPTRFLVSQG 84 >SB_17568| Best HMM Match : Ldl_recept_a (HMM E-Value=0.04) Length = 189 Score = 27.1 bits (57), Expect = 3.5 Identities = 16/35 (45%), Positives = 23/35 (65%) Frame = +1 Query: 1 RVREIEYKKQRDIEEKRQRLEEAEKKRQAMLQAMK 105 R EIE KQ+ +E+ R +LE+ +K+ A LQA K Sbjct: 136 RRHEIELAKQKKLEDLRLQLEQ-KKQVVAELQATK 169 >SB_47024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 975 Score = 26.6 bits (56), Expect = 4.6 Identities = 11/28 (39%), Positives = 20/28 (71%) Frame = +1 Query: 1 RVREIEYKKQRDIEEKRQRLEEAEKKRQ 84 R REI +++R+ EE +++ EEA +R+ Sbjct: 724 REREIREREEREWEENKRKHEEARLQRE 751 >SB_7313| Best HMM Match : IQ (HMM E-Value=0.00059) Length = 104 Score = 26.6 bits (56), Expect = 4.6 Identities = 10/33 (30%), Positives = 23/33 (69%) Frame = +1 Query: 10 EIEYKKQRDIEEKRQRLEEAEKKRQAMLQAMKG 108 + E ++Q++ EE+++R EEA+++ + + A G Sbjct: 61 QAEKERQKEEEERKRRKEEAKRRARILEAAFDG 93 >SB_53672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 675 Score = 26.6 bits (56), Expect = 4.6 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 Query: 127 PNFTIQKKSENFGLSNAQLERNKTK 201 P T + EN GLSN L ++KTK Sbjct: 498 PTPTSSQTQENIGLSNGTLTQDKTK 522 >SB_36059| Best HMM Match : TolA (HMM E-Value=0.1) Length = 1936 Score = 26.6 bits (56), Expect = 4.6 Identities = 25/92 (27%), Positives = 41/92 (44%) Frame = +1 Query: 16 EYKKQRDIEEKRQRLEEAEKKRQAMLQAMKGCQQGPGPNFTIQKKSENFGLSNAQLERNK 195 E + Q +EEKR E+ K+++ Q G ++ G +KK E S+ +L + Sbjct: 1226 EKEMQALLEEKRLEEEKNAKRKRPGQQGGPGSKEKKGHEEKKEKKPEK---SSDKLSSGR 1282 Query: 196 TKGAAGRGEKNLPVHSH*AADHRGSLRSTNSD 291 A + + NL + A S RS +SD Sbjct: 1283 VTAVASQAQ-NLEAQTRGGAPSVISERSDSSD 1313 >SB_31228| Best HMM Match : EMP24_GP25L (HMM E-Value=0.22) Length = 350 Score = 26.6 bits (56), Expect = 4.6 Identities = 11/32 (34%), Positives = 23/32 (71%) Frame = +1 Query: 1 RVREIEYKKQRDIEEKRQRLEEAEKKRQAMLQ 96 R++ E +++ EE+R R+EE +++++ MLQ Sbjct: 107 RIQAEEEARRKAEEEERIRIEEIKRQQEKMLQ 138 >SB_18786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1056 Score = 26.6 bits (56), Expect = 4.6 Identities = 15/43 (34%), Positives = 24/43 (55%) Frame = -3 Query: 234 REIFFSSSSCSLGLVALQLGIAQTEVFALLLDGEVGSRSLLAS 106 +++F + ++ S GLV+ AQ+ V LL G+V S L S Sbjct: 722 QKVFVTQAAASTGLVSSSGKPAQSVVTTRLLSGQVPSSGLTTS 764 >SB_49662| Best HMM Match : Bromodomain (HMM E-Value=9.8e-38) Length = 1301 Score = 26.2 bits (55), Expect = 6.1 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = +1 Query: 7 REIEYKKQRDIEEKRQRLEEAEKKRQAMLQAMKGCQQGPG 126 R E KKQ D E+++++ AEK+++A + G ++ G Sbjct: 247 RAAESKKQEDEEKEKEKQLVAEKRQKAFWLSGTGREKSGG 286 >SB_49384| Best HMM Match : GNT-I (HMM E-Value=0) Length = 361 Score = 26.2 bits (55), Expect = 6.1 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -1 Query: 212 PAAPLVLLRSSWALLKPKFSLFFW 141 P +L +S W LKPK+ L FW Sbjct: 218 PGLGWMLTKSIWNELKPKWPLGFW 241 >SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) Length = 1290 Score = 26.2 bits (55), Expect = 6.1 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = -1 Query: 320 DALPEFLAFLSEFVERRDPRWSAA 249 ++L L+ L E ++RRD RWSAA Sbjct: 900 ESLKAQLSELQEEMKRRDSRWSAA 923 >SB_37864| Best HMM Match : Extensin_2 (HMM E-Value=0.064) Length = 1230 Score = 26.2 bits (55), Expect = 6.1 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +1 Query: 10 EIEYKKQRDIEEKRQRLEEAEKKRQA 87 E E KK+RD ++ R EEAE ++QA Sbjct: 1063 ETETKKERDQTDQAIRDEEAELEKQA 1088 >SB_24800| Best HMM Match : DUF866 (HMM E-Value=4) Length = 393 Score = 26.2 bits (55), Expect = 6.1 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +1 Query: 1 RVREIEYKKQRDIEEKRQRLEEAEKKRQAMLQAMKGCQQGPG 126 RVR EYK + + +R+ L+ KK++ + +G PG Sbjct: 350 RVRLAEYKSKEASKRRRKVLKGKRKKKEDKKKQAEGSLYDPG 391 >SB_24366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 351 Score = 26.2 bits (55), Expect = 6.1 Identities = 19/82 (23%), Positives = 41/82 (50%), Gaps = 1/82 (1%) Frame = +1 Query: 1 RVREIEYKKQRDIEEK-RQRLEEAEKKRQAMLQAMKGCQQGPGPNFTIQKKSENFGLSNA 177 +V+ +++ ++ + E+ R LEE E+K+Q + + + ++G +KK N +SN Sbjct: 93 KVKRLDFLREESMHEQARMFLEEREEKKQELSEVI---EEGRKRKRNRRKKG-NGNVSNM 148 Query: 178 QLERNKTKGAAGRGEKNLPVHS 243 + + G +N +HS Sbjct: 149 TEKVTRLDGECNNTTRNHILHS 170 >SB_46756| Best HMM Match : zf-C2H2 (HMM E-Value=4.60046e-42) Length = 1078 Score = 26.2 bits (55), Expect = 6.1 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = +1 Query: 40 EEKRQRLEEAEKKRQAMLQAMKG 108 EE+RQ+ EEA K+R+ L A KG Sbjct: 537 EERRQKREEARKRREEKL-AKKG 558 >SB_44274| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 26.2 bits (55), Expect = 6.1 Identities = 14/56 (25%), Positives = 25/56 (44%) Frame = +1 Query: 34 DIEEKRQRLEEAEKKRQAMLQAMKGCQQGPGPNFTIQKKSENFGLSNAQLERNKTK 201 D+ + LE K ++ +Q +K C P P + +K N LS+ + + K Sbjct: 311 DLGAEHVLLESMPKHKELWMQWLKQCPHTPKPLKKMNEKEVNKWLSSTEFQEFSKK 366 >SB_40403| Best HMM Match : Vicilin_N (HMM E-Value=0.012) Length = 1119 Score = 26.2 bits (55), Expect = 6.1 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +1 Query: 13 IEYKKQRDIEEKRQRLEEAEKKRQA 87 IE +Q++ E +R R E EK+RQA Sbjct: 351 IEDMRQKEAERQRVREAEEEKRRQA 375 Score = 25.8 bits (54), Expect = 8.1 Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 2/34 (5%) Frame = +1 Query: 1 RVREIEYKKQRD--IEEKRQRLEEAEKKRQAMLQ 96 R R+ K++ D +++KR R EE +++RQ LQ Sbjct: 647 RFRQESLKREADELMQQKRIREEELQRRRQQALQ 680 >SB_39563| Best HMM Match : Ctr (HMM E-Value=0.39) Length = 258 Score = 26.2 bits (55), Expect = 6.1 Identities = 14/47 (29%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +2 Query: 113 SKDRDPTSPSKRRAKTSV*AMPSWSATRPR-EQLEEEKKISLFIRIK 250 S + PT P+ R+A+ S+ PS+S +R + Q + + + + R K Sbjct: 196 SAEASPTQPTVRKAEHSIEPNPSYSKSRGKTAQASQHSRGASYFRKK 242 >SB_8304| Best HMM Match : PLAT (HMM E-Value=0) Length = 1182 Score = 26.2 bits (55), Expect = 6.1 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +1 Query: 7 REIEYKKQRDIEEKRQRLEEAEKKRQA 87 +E E KK+++ EE+R+ +E K+QA Sbjct: 932 KEEEEKKEKEAEERRRAEDEERIKKQA 958 >SB_7408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 26.2 bits (55), Expect = 6.1 Identities = 11/39 (28%), Positives = 24/39 (61%) Frame = +1 Query: 1 RVREIEYKKQRDIEEKRQRLEEAEKKRQAMLQAMKGCQQ 117 R R+ + ++QR + +RQR + +++RQ Q ++ Q+ Sbjct: 57 RQRQRQRQRQRQRQRQRQRQRQRQRQRQRQRQRLRQRQR 95 Score = 26.2 bits (55), Expect = 6.1 Identities = 13/44 (29%), Positives = 24/44 (54%) Frame = +1 Query: 1 RVREIEYKKQRDIEEKRQRLEEAEKKRQAMLQAMKGCQQGPGPN 132 R R+ + ++QR + +RQR + ++RQ + Q + QQ N Sbjct: 67 RQRQRQRQRQRQRQRQRQRQRQRLRQRQRLRQRQRQRQQQRNDN 110 >SB_2860| Best HMM Match : IncA (HMM E-Value=0.41) Length = 417 Score = 26.2 bits (55), Expect = 6.1 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 6/66 (9%) Frame = +1 Query: 10 EIEYKKQRDIEEKRQRLEE----AEKKRQAMLQAMKGCQQG--PGPNFTIQKKSENFGLS 171 E+E K RD+E+++QRL E AEK+ Q ++ P +Q + + + Sbjct: 185 EMERSKVRDLEQQKQRLVEQLYAAEKRYQDKENEFMTHKERELSKPEVKLQSELDFLRVE 244 Query: 172 NAQLER 189 A+LER Sbjct: 245 KAELER 250 >SB_53319| Best HMM Match : zf-CW (HMM E-Value=7.7e-17) Length = 714 Score = 25.8 bits (54), Expect = 8.1 Identities = 9/33 (27%), Positives = 23/33 (69%) Frame = +1 Query: 7 REIEYKKQRDIEEKRQRLEEAEKKRQAMLQAMK 105 RE +K+R++E +RQR+++ E+ +++ ++ Sbjct: 156 REARAEKERELEMERQRIKKKEQDLNRLMKIVE 188 >SB_45896| Best HMM Match : ApoC-I (HMM E-Value=4) Length = 104 Score = 25.8 bits (54), Expect = 8.1 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +1 Query: 1 RVREIEYKKQRDIEEKRQRLEEAEKKRQAMLQAMKGCQQGPG 126 RVR EYK + + +R+ L KK++ + +G PG Sbjct: 61 RVRLAEYKSKEASKRRRKVLRGKRKKKEDKKKQAEGSLYDPG 102 >SB_45045| Best HMM Match : Kinesin (HMM E-Value=0) Length = 1260 Score = 25.8 bits (54), Expect = 8.1 Identities = 16/79 (20%), Positives = 34/79 (43%) Frame = +1 Query: 10 EIEYKKQRDIEEKRQRLEEAEKKRQAMLQAMKGCQQGPGPNFTIQKKSENFGLSNAQLER 189 E+E+ ++ EKR+ L +++R + Q++ G G + K + + LS Sbjct: 675 ELEHLRRELQAEKRRSLALEQRERDILEQSIAGGSHGLSETEDVHKDAGDIELSEGHRTN 734 Query: 190 NKTKGAAGRGEKNLPVHSH 246 ++ +P+ SH Sbjct: 735 CQSPEHLAPQFPQIPIDSH 753 >SB_30234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5222 Score = 25.8 bits (54), Expect = 8.1 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = +3 Query: 174 CPAGAQQDQGSSWKRRKKSPC 236 CPAG + G W R + PC Sbjct: 2458 CPAGFYHNAGRIWNRTQCMPC 2478 >SB_30003| Best HMM Match : DUF906 (HMM E-Value=0) Length = 2276 Score = 25.8 bits (54), Expect = 8.1 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +1 Query: 19 YKKQRDIEEKRQRLEEAEKKRQAMLQAMKGCQQGP 123 YK Q+++EEKRQR A+ + A Q G Q P Sbjct: 570 YKIQKELEEKRQRRLLAQMRTTAAPQV--GQNQAP 602 >SB_27235| Best HMM Match : ApoC-I (HMM E-Value=4) Length = 158 Score = 25.8 bits (54), Expect = 8.1 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +1 Query: 1 RVREIEYKKQRDIEEKRQRLEEAEKKRQAMLQAMKGCQQGPG 126 RVR EYK + + +R+ L KK++ + +G PG Sbjct: 115 RVRLAEYKSKEASKRRRKVLRGKRKKKEDKKKQAEGSLYDPG 156 >SB_24613| Best HMM Match : Ctr (HMM E-Value=0.73) Length = 895 Score = 25.8 bits (54), Expect = 8.1 Identities = 14/72 (19%), Positives = 37/72 (51%) Frame = +1 Query: 13 IEYKKQRDIEEKRQRLEEAEKKRQAMLQAMKGCQQGPGPNFTIQKKSENFGLSNAQLERN 192 IE +++ E ++++L+E+ + ++++ G K+ + +SN Q ++ Sbjct: 532 IEDNEKKRKETEKKKLKESIESFDTSVESIGSNSTGSPGRDKSDKQRKITQISNGQEDKE 591 Query: 193 KTKGAAGRGEKN 228 G+ GRG+++ Sbjct: 592 LRTGSQGRGDED 603 >SB_22653| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 737 Score = 25.8 bits (54), Expect = 8.1 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = +1 Query: 1 RVREIEYKKQRDIEEKRQRLEEAEKKRQ 84 R RE E KK RD EKR+R E K R+ Sbjct: 216 RKREKEEKK-RDKSEKRERSRERSKDRK 242 >SB_21999| Best HMM Match : ApoC-I (HMM E-Value=4) Length = 104 Score = 25.8 bits (54), Expect = 8.1 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +1 Query: 1 RVREIEYKKQRDIEEKRQRLEEAEKKRQAMLQAMKGCQQGPG 126 RVR EYK + + +R+ L KK++ + +G PG Sbjct: 61 RVRLAEYKSKEASKRRRKVLRGKRKKKEDKKKQAEGSLYDPG 102 >SB_14000| Best HMM Match : DUF1213 (HMM E-Value=0.71) Length = 1281 Score = 25.8 bits (54), Expect = 8.1 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = +2 Query: 116 KDRDPTSPSKRRAKTSV*AMPSWSATRPREQLEEEKK 226 +D+ T P+ R KTS A RPRE + K+ Sbjct: 178 QDKQATRPTSHRIKTSKLQDQDKQAARPREASHKTKR 214 >SB_3246| Best HMM Match : ApoC-I (HMM E-Value=4) Length = 75 Score = 25.8 bits (54), Expect = 8.1 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +1 Query: 1 RVREIEYKKQRDIEEKRQRLEEAEKKRQAMLQAMKGCQQGPG 126 RVR EYK + + +R+ L KK++ + +G PG Sbjct: 32 RVRLAEYKSKEASKRRRKVLRGKRKKKEDKKKQAEGSLYDPG 73 >SB_59533| Best HMM Match : ApoC-I (HMM E-Value=4) Length = 75 Score = 25.8 bits (54), Expect = 8.1 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +1 Query: 1 RVREIEYKKQRDIEEKRQRLEEAEKKRQAMLQAMKGCQQGPG 126 RVR EYK + + +R+ L KK++ + +G PG Sbjct: 32 RVRLAEYKSKEASKRRRKVLRGKRKKKEDKKKQAEGSLYDPG 73 >SB_52528| Best HMM Match : HLH (HMM E-Value=3.9e-18) Length = 138 Score = 25.8 bits (54), Expect = 8.1 Identities = 22/110 (20%), Positives = 47/110 (42%), Gaps = 3/110 (2%) Frame = +1 Query: 1 RVREIEYKKQRDIEEKRQRLEEAEKKRQAMLQA--MKGCQQGPGPNFTIQKKSENFGLSN 174 R+ + +++ E +R R+++ + + ++ ++ P TI+ + Sbjct: 29 RLTGVSKQRRTANERERNRVQQVNAAFETLRNKIPLRALEKKPSKIDTIRLATRYIQDLT 88 Query: 175 AQLERNKTKGA-AGRGEKNLPVHSH*AADHRGSLRSTNSDRKARNSGSAS 321 L +T+G N V+S ADH GSL S+ +D+ + +S Sbjct: 89 QLLSLAETEGRITSPSSSNGSVYSSTIADHDGSLYSSTTDQDGKTDEDSS 138 >SB_44773| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 25.8 bits (54), Expect = 8.1 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +1 Query: 1 RVREIEYKKQRDIEEKRQRLEEAEKKRQAMLQAMKGCQQGPG 126 RVR EYK + + +R+ L KK++ + +G PG Sbjct: 61 RVRLAEYKSKEASKRRRKVLRGKRKKKEDKKKQAEGSLYDPG 102 >SB_31678| Best HMM Match : ApoC-I (HMM E-Value=4) Length = 298 Score = 25.8 bits (54), Expect = 8.1 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +1 Query: 1 RVREIEYKKQRDIEEKRQRLEEAEKKRQAMLQAMKGCQQGPG 126 RVR EYK + + +R+ L KK++ + +G PG Sbjct: 255 RVRLAEYKSKEASKRRRKVLRGKRKKKEDKKKQAEGSLYDPG 296 >SB_11764| Best HMM Match : DSHCT (HMM E-Value=1.9e-27) Length = 1492 Score = 25.8 bits (54), Expect = 8.1 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +1 Query: 16 EYKKQRDIEEKRQRLEEAEKK 78 E+ QRD E+RQ+ E+ EK+ Sbjct: 582 EFHLQRDATERRQKAEQLEKE 602 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.314 0.128 0.354 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,486,438 Number of Sequences: 59808 Number of extensions: 183399 Number of successful extensions: 814 Number of sequences better than 10.0: 76 Number of HSP's better than 10.0 without gapping: 667 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 788 length of database: 16,821,457 effective HSP length: 72 effective length of database: 12,515,281 effective search space used: 438034835 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits)
- SilkBase 1999-2023 -