BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31196 (582 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 27 0.15 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 27 0.15 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 27 0.15 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 27 0.15 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 27 0.15 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 27 0.15 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 27 0.15 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 27 0.15 EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 ... 24 1.1 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 24 1.1 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 24 1.1 AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 ... 23 1.4 AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory recept... 23 2.5 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 21 5.8 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 26.6 bits (56), Expect = 0.15 Identities = 11/36 (30%), Positives = 14/36 (38%) Frame = +2 Query: 350 GIQHCSPARREAYHSPCQSHPHTLPARWSHPHTLPA 457 G + +P Y C S P P HP+ PA Sbjct: 26 GTDYYNPNANSTYPPACYSPPQVAPQYPQHPYAAPA 61 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 26.6 bits (56), Expect = 0.15 Identities = 11/36 (30%), Positives = 14/36 (38%) Frame = +2 Query: 350 GIQHCSPARREAYHSPCQSHPHTLPARWSHPHTLPA 457 G + +P Y C S P P HP+ PA Sbjct: 26 GTDYYNPNANSTYPPACYSPPQVAPQYPQHPYAAPA 61 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 26.6 bits (56), Expect = 0.15 Identities = 11/36 (30%), Positives = 14/36 (38%) Frame = +2 Query: 350 GIQHCSPARREAYHSPCQSHPHTLPARWSHPHTLPA 457 G + +P Y C S P P HP+ PA Sbjct: 26 GTDYYNPNANSTYPPACYSPPQVAPQYPQHPYAAPA 61 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 26.6 bits (56), Expect = 0.15 Identities = 11/36 (30%), Positives = 14/36 (38%) Frame = +2 Query: 350 GIQHCSPARREAYHSPCQSHPHTLPARWSHPHTLPA 457 G + +P Y C S P P HP+ PA Sbjct: 26 GTDYYNPNANSTYPPACYSPPQVAPQYPQHPYAAPA 61 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 26.6 bits (56), Expect = 0.15 Identities = 11/36 (30%), Positives = 14/36 (38%) Frame = +2 Query: 350 GIQHCSPARREAYHSPCQSHPHTLPARWSHPHTLPA 457 G + +P Y C S P P HP+ PA Sbjct: 26 GTDYYNPNANSTYPPACYSPPQVAPQYPQHPYAAPA 61 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 26.6 bits (56), Expect = 0.15 Identities = 11/36 (30%), Positives = 14/36 (38%) Frame = +2 Query: 350 GIQHCSPARREAYHSPCQSHPHTLPARWSHPHTLPA 457 G + +P Y C S P P HP+ PA Sbjct: 26 GTDYYNPNANSTYPPACYSPPQVAPQYPQHPYAAPA 61 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 26.6 bits (56), Expect = 0.15 Identities = 11/36 (30%), Positives = 14/36 (38%) Frame = +2 Query: 350 GIQHCSPARREAYHSPCQSHPHTLPARWSHPHTLPA 457 G + +P Y C S P P HP+ PA Sbjct: 26 GTDYYNPNANSTYPPACYSPPQVAPQYPQHPYAAPA 61 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 26.6 bits (56), Expect = 0.15 Identities = 11/36 (30%), Positives = 14/36 (38%) Frame = +2 Query: 350 GIQHCSPARREAYHSPCQSHPHTLPARWSHPHTLPA 457 G + +P Y C S P P HP+ PA Sbjct: 26 GTDYYNPNANSTYPPACYSPPQVAPQYPQHPYAAPA 61 >EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 protein. Length = 493 Score = 23.8 bits (49), Expect = 1.1 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +3 Query: 81 LLSSTTRVYSTVSPFVYKPGRYVADPGRYDP 173 LL S + S V FV+ P P R+DP Sbjct: 444 LLVSKVALASVVKDFVFDPTERTPVPLRFDP 474 Score = 23.0 bits (47), Expect = 1.9 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +3 Query: 114 VSPFVYKPGRYVADPGRYDPSR 179 +S Y P Y DP +YDP R Sbjct: 393 ISGLHYDP-EYYPDPEKYDPER 413 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 23.8 bits (49), Expect = 1.1 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -1 Query: 435 DHLAGNVCGCDWHGEW 388 +H+ GN WHG W Sbjct: 190 NHIEGNEVTLHWHGVW 205 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 23.8 bits (49), Expect = 1.1 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -1 Query: 435 DHLAGNVCGCDWHGEW 388 +H+ GN WHG W Sbjct: 190 NHIEGNEVTLHWHGVW 205 >AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 463 Score = 23.4 bits (48), Expect = 1.4 Identities = 8/29 (27%), Positives = 17/29 (58%), Gaps = 3/29 (10%) Frame = +3 Query: 126 VYKPGRYVADPGRYDPSR---DNSGRYIP 203 +++ +Y DP ++DP R +N + +P Sbjct: 383 IHRDPQYFPDPEKFDPERFSDENKAKIVP 411 >AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory receptor candidate 34 protein. Length = 324 Score = 22.6 bits (46), Expect = 2.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +1 Query: 52 GAGRRNWKVHSFPVQPEFTLLFLHSSISQ 138 G G ++ K++SF + TLL + SSI + Sbjct: 17 GIGPKSNKIYSFLLLTTLTLLVILSSIDR 45 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.4 bits (43), Expect = 5.8 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +2 Query: 71 GKYTPFQYNPSL 106 GK+TP NPSL Sbjct: 539 GKFTPEDINPSL 550 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,577 Number of Sequences: 336 Number of extensions: 2320 Number of successful extensions: 18 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14517299 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -