BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31195 (370 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. 43 1e-06 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 22 2.0 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 3.5 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 4.6 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 21 6.1 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 20 8.1 >AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. Length = 133 Score = 42.7 bits (96), Expect = 1e-06 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 315 GQVITIGNERFRCPEALF 368 GQVITIGNERFRCPEALF Sbjct: 20 GQVITIGNERFRCPEALF 37 Score = 37.1 bits (82), Expect = 7e-05 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = +2 Query: 257 EMGTAGASTSLEKSYELPDG 316 EM TA +S+SLEKSYELPDG Sbjct: 1 EMATAASSSSLEKSYELPDG 20 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 22.2 bits (45), Expect = 2.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +2 Query: 98 PRHPPSGLGWSRLDRLPHENPHREGLLVHH 187 P H G G S + PH + H HH Sbjct: 414 PHHHTMGHGHSHIHATPHHH-HSHAATPHH 442 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 3.5 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = -2 Query: 324 SPAPSGSS*DFSREVEAPAVPISCSKS 244 SP+ G + D S + +P P+S S++ Sbjct: 1380 SPSDRGRNDDGSDRLTSPPTPLSISRA 1406 Score = 21.0 bits (42), Expect = 4.6 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +2 Query: 56 CLPHRTHLRRLRSAPRHPPS 115 C P +L ++ S P HPP+ Sbjct: 79 CDPVPGNLEQIGSRPLHPPA 98 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.0 bits (42), Expect = 4.6 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = +3 Query: 60 SHTVPIYEGYALPHAILRLDLAGRDLTDYLMKI 158 +H + Y GY P + D A + T+ MK+ Sbjct: 187 NHQLISYAGYKNPDGTIIGDPANIEFTELCMKL 219 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 20.6 bits (41), Expect = 6.1 Identities = 15/57 (26%), Positives = 26/57 (45%), Gaps = 1/57 (1%) Frame = -3 Query: 221 LDVTNDFPLSGGGERVTPLGEDFHEVVGQVATSQVQTEDGVGQS-VTFVDGYGVGDT 54 +D+T S G+ V + + +VG A + E+G G + VT + + DT Sbjct: 19 VDLTQCLQESSTGQSVEFSPMELNALVGTPAAPNMPAEEGEGMAGVTGEEPFDTLDT 75 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 20.2 bits (40), Expect = 8.1 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -2 Query: 87 NLRRWVRCGRHH 52 +L R RCGR+H Sbjct: 412 DLMRNTRCGRYH 423 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,457 Number of Sequences: 438 Number of extensions: 2143 Number of successful extensions: 11 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 8804355 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -