Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= epV31193
         (501 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q7RJ94 Cluster: Putative uncharacterized protein PY0336...    33   3.6  

>UniRef50_Q7RJ94 Cluster: Putative uncharacterized protein PY03369;
           n=6; Plasmodium (Vinckeia)|Rep: Putative uncharacterized
           protein PY03369 - Plasmodium yoelii yoelii
          Length = 625

 Score = 33.1 bits (72), Expect = 3.6
 Identities = 22/57 (38%), Positives = 31/57 (54%), Gaps = 4/57 (7%)
 Frame = -3

Query: 373 IKLRINFVNSSQNI---GKLKKN*N*TTLFM-SIYENNTGDTKCLRILTHFRIFLEN 215
           IK   NFVNS   I    K  KN N   +F+   Y+N  G+ + + I+  FR+FL+N
Sbjct: 202 IKSFNNFVNSIDTIFILNKQPKNNNYNVIFLIHNYDNKNGNEEKIEIMKIFRMFLKN 258


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 338,843,187
Number of Sequences: 1657284
Number of extensions: 5275570
Number of successful extensions: 7339
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 7196
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7336
length of database: 575,637,011
effective HSP length: 95
effective length of database: 418,195,031
effective search space used: 29691847201
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)