BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31193 (501 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q7RJ94 Cluster: Putative uncharacterized protein PY0336... 33 3.6 >UniRef50_Q7RJ94 Cluster: Putative uncharacterized protein PY03369; n=6; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein PY03369 - Plasmodium yoelii yoelii Length = 625 Score = 33.1 bits (72), Expect = 3.6 Identities = 22/57 (38%), Positives = 31/57 (54%), Gaps = 4/57 (7%) Frame = -3 Query: 373 IKLRINFVNSSQNI---GKLKKN*N*TTLFM-SIYENNTGDTKCLRILTHFRIFLEN 215 IK NFVNS I K KN N +F+ Y+N G+ + + I+ FR+FL+N Sbjct: 202 IKSFNNFVNSIDTIFILNKQPKNNNYNVIFLIHNYDNKNGNEEKIEIMKIFRMFLKN 258 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 338,843,187 Number of Sequences: 1657284 Number of extensions: 5275570 Number of successful extensions: 7339 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 7196 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7336 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 29691847201 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -