BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31193 (501 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC092690-3|AAK73857.1| 1145|Caenorhabditis elegans Hypothetical ... 27 5.8 AF022974-2|AAC48038.1| 344|Caenorhabditis elegans Seven tm rece... 27 7.6 >AC092690-3|AAK73857.1| 1145|Caenorhabditis elegans Hypothetical protein BE0003N10.3 protein. Length = 1145 Score = 27.5 bits (58), Expect = 5.8 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -2 Query: 140 QQFDAFN*TSIKFTPFK*LKKFMFICYDLNFSP 42 QQF F + + K L K F+CYD F+P Sbjct: 432 QQFKIFRQLNFQGPATKTLGKLKFLCYDEEFNP 464 >AF022974-2|AAC48038.1| 344|Caenorhabditis elegans Seven tm receptor protein 209 protein. Length = 344 Score = 27.1 bits (57), Expect = 7.6 Identities = 18/65 (27%), Positives = 33/65 (50%) Frame = -1 Query: 288 VFMRIILVIPNVYAY*LISEYSWKIYTFNAKRRIILVIIIRGAFYLILASTVRCV*LNFN 109 +F I ++ N+ LI+E S K + +I+++ I FY +L TVR V +F Sbjct: 13 IFGVIFALLHNLLLIFLITEKSHK--ELGTYKNLIILVAISECFYAVLEVTVRPVIHSFG 70 Query: 108 *VYSI 94 +++ Sbjct: 71 FTFAL 75 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,023,732 Number of Sequences: 27780 Number of extensions: 130463 Number of successful extensions: 187 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 185 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 187 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 956602620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -