BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31191 (543 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28689| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_43382| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 >SB_28689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 369 Score = 28.3 bits (60), Expect = 4.3 Identities = 25/70 (35%), Positives = 29/70 (41%), Gaps = 6/70 (8%) Frame = +1 Query: 193 PSNHVSHFNYIDFIFFRSD*----ASVTSKSIL*SFSRDTDHENDIKTIVMKRPCSLGL- 357 P N Y D + R+D AS K IL S D N+I + MKR LG Sbjct: 211 PENSPEKARYTDALSLRNDWRTAKASGDYKGILAFLSATFDSVNEINAVFMKREDCLGPE 270 Query: 358 -GDGSALQSD 384 DGS L D Sbjct: 271 DEDGSGLDYD 280 >SB_43382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 861 Score = 27.1 bits (57), Expect = 9.9 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -2 Query: 149 NKNCINPSLDKIRLYKVPKTIIIY 78 N NC + SLDK Y PK +Y Sbjct: 13 NNNCFSDSLDKAVTYSSPKDDFLY 36 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,401,243 Number of Sequences: 59808 Number of extensions: 224389 Number of successful extensions: 489 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 442 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 486 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1239956166 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -