BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31191 (543 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette... 24 3.7 U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette... 24 3.7 U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette... 24 3.7 >U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 23.8 bits (49), Expect = 3.7 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = +1 Query: 88 IVFGTLYKRILSSDGFIQFLFYISHFYYYN 177 ++FG + S + ++L Y+S F Y N Sbjct: 594 LIFGGFFLNSASVPAYFKYLSYLSWFRYAN 623 >U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 23.8 bits (49), Expect = 3.7 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = +1 Query: 88 IVFGTLYKRILSSDGFIQFLFYISHFYYYN 177 ++FG + S + ++L Y+S F Y N Sbjct: 594 LIFGGFFLNSASVPAYFKYLSYLSWFRYAN 623 >U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette protein protein. Length = 673 Score = 23.8 bits (49), Expect = 3.7 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = +1 Query: 88 IVFGTLYKRILSSDGFIQFLFYISHFYYYN 177 ++FG + S + ++L Y+S F Y N Sbjct: 572 LIFGGFFLNSASVPAYFKYLSYLSWFRYAN 601 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 461,531 Number of Sequences: 2352 Number of extensions: 7912 Number of successful extensions: 13 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50040333 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -