BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31191 (543 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U80445-6|AAB37797.2| 575|Caenorhabditis elegans Hypothetical pr... 28 3.8 U41543-8|AAB37025.2| 393|Caenorhabditis elegans Hypothetical pr... 27 6.6 >U80445-6|AAB37797.2| 575|Caenorhabditis elegans Hypothetical protein C50F2.1 protein. Length = 575 Score = 28.3 bits (60), Expect = 3.8 Identities = 14/50 (28%), Positives = 25/50 (50%) Frame = -1 Query: 354 AQRTRAFHYNGLYIIFMISISRKRLQDTLRCNRRSIRPKKYKINIVKMRN 205 + + + YNG Y S+ +K + C R I+ K+Y IN++ + N Sbjct: 11 SDKVTEYIYNGSYDSINYSLDQKSNLKNIGCFYRDIKDKQY-INLISLMN 59 >U41543-8|AAB37025.2| 393|Caenorhabditis elegans Hypothetical protein F46H5.8 protein. Length = 393 Score = 27.5 bits (58), Expect = 6.6 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -3 Query: 361 LPSPANTGVSLQWSLYHFHDQYLSKTI 281 LP P+N G+S L HFH +K I Sbjct: 270 LPMPSNMGISNAEGLAHFHSLVANKQI 296 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,255,365 Number of Sequences: 27780 Number of extensions: 171959 Number of successful extensions: 426 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 401 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 426 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1091917214 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -