BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31191 (543 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 21 6.1 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 21 6.1 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 21 6.1 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 21 6.1 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 6.1 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 21 8.1 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 6.1 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 190 LPSNHVSHFNYIDFI 234 LP NH+ + Y+D I Sbjct: 361 LPENHLKNAKYLDVI 375 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 6.1 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 190 LPSNHVSHFNYIDFI 234 LP NH+ + Y+D I Sbjct: 361 LPENHLKNAKYLDVI 375 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 21.4 bits (43), Expect = 6.1 Identities = 11/40 (27%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +1 Query: 205 VSHFNYIDFIFFRSD*ASVTSKSIL*SFSRDTDH-ENDIK 321 + HFNY+ IF S + +++L F + + E+D++ Sbjct: 162 LKHFNYMKVIFIHS--SDTDGRALLGRFQTTSQNLEDDVE 199 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 6.1 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 190 LPSNHVSHFNYIDFI 234 LP NH+ + Y+D I Sbjct: 361 LPENHLKNAKYLDVI 375 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 318 KDHCNETPVFAGLGRRIGAS 377 +DHCN+T V + +GA+ Sbjct: 200 EDHCNKTAVRKVISGVVGAA 219 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.0 bits (42), Expect = 8.1 Identities = 6/13 (46%), Positives = 11/13 (84%) Frame = -2 Query: 143 NCINPSLDKIRLY 105 NC++P+L K+ L+ Sbjct: 594 NCLDPNLPKLALF 606 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 130,599 Number of Sequences: 438 Number of extensions: 2205 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15459066 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -