BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31182 (610 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0444 - 9444340-9444829,9444985-9445688 29 3.8 08_01_0130 + 1040696-1041049,1042135-1042275,1042422-1042673,104... 28 6.7 >09_02_0444 - 9444340-9444829,9444985-9445688 Length = 397 Score = 28.7 bits (61), Expect = 3.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -2 Query: 258 AYVSGNYNIRENPNFNW 208 AY G+Y++ +NPN+ W Sbjct: 84 AYTVGSYHVADNPNYRW 100 >08_01_0130 + 1040696-1041049,1042135-1042275,1042422-1042673, 1043797-1043904,1044289-1044593,1044720-1044841, 1044979-1045225,1045308-1045365,1045414-1045530, 1045718-1045753,1046492-1046554,1046958-1047047, 1047241-1047399,1047475-1047596,1048145-1048217, 1048307-1048375 Length = 771 Score = 27.9 bits (59), Expect = 6.7 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +2 Query: 92 YISTRTIFLYELAKVSAIYNAIGKSVNNVKI 184 YIS T+ EL+ S++Y I SVN K+ Sbjct: 98 YISMGTLVRQELSPASSLYKKIANSVNEGKL 128 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,189,657 Number of Sequences: 37544 Number of extensions: 240892 Number of successful extensions: 446 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 437 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 446 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1454766756 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -