BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31182 (610 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 24 4.4 AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled ... 24 4.4 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.8 bits (49), Expect = 4.4 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = -3 Query: 308 GWWYLSVRTHERSSHCVHMFQETTTSEKILTLI 210 G Y+S+ +HE S +H F+ + I+ +I Sbjct: 1075 GLLYVSIDSHEEDSGPIHNFRPIVAAYYIIYII 1107 >AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled receptor 3 protein. Length = 605 Score = 23.8 bits (49), Expect = 4.4 Identities = 13/42 (30%), Positives = 20/42 (47%) Frame = +2 Query: 146 YNAIGKSVNNVKIW*LAFQIPQLKLGFSLML*FPETYAHSER 271 Y+AI +N W A ++ FS++ P TY + ER Sbjct: 325 YDAITHPMNFSGCWSRARKLVAAAWSFSILFSLPITYFYEER 366 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 501,113 Number of Sequences: 2352 Number of extensions: 8804 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 59291487 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -