BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31182 (610 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U22831-9|AAN63388.1| 412|Caenorhabditis elegans Hypothetical pr... 28 4.5 U22831-8|AAK20070.2| 545|Caenorhabditis elegans Hypothetical pr... 28 4.5 >U22831-9|AAN63388.1| 412|Caenorhabditis elegans Hypothetical protein F47D12.9b protein. Length = 412 Score = 28.3 bits (60), Expect = 4.5 Identities = 17/52 (32%), Positives = 26/52 (50%) Frame = +2 Query: 137 SAIYNAIGKSVNNVKIW*LAFQIPQLKLGFSLML*FPETYAHSERTFRESAR 292 S IYN + N IW + + PQ+ +GF L F ++R+F S+R Sbjct: 191 SPIYNKSWREKGN--IWSVGWNAPQMSIGFGLESCFRVENLLTDRSFLMSSR 240 >U22831-8|AAK20070.2| 545|Caenorhabditis elegans Hypothetical protein F47D12.9a protein. Length = 545 Score = 28.3 bits (60), Expect = 4.5 Identities = 17/52 (32%), Positives = 26/52 (50%) Frame = +2 Query: 137 SAIYNAIGKSVNNVKIW*LAFQIPQLKLGFSLML*FPETYAHSERTFRESAR 292 S IYN + N IW + + PQ+ +GF L F ++R+F S+R Sbjct: 324 SPIYNKSWREKGN--IWSVGWNAPQMSIGFGLESCFRVENLLTDRSFLMSSR 373 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,938,120 Number of Sequences: 27780 Number of extensions: 195285 Number of successful extensions: 368 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 366 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 368 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1311096392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -