BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31180 (672 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 24 1.5 AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 21 8.1 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 23.8 bits (49), Expect = 1.5 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = +3 Query: 57 EYVDFTLNSFALRI*GLGRFLISHRKNYRFVINLKRKKEKKTFER 191 +++DF S R + H KNY F ++ R K T ER Sbjct: 44 KHIDFDFGSDERRDAAIKSGEFDHTKNYPFDVDRWRDKTFVTIER 88 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 21.4 bits (43), Expect = 8.1 Identities = 8/25 (32%), Positives = 12/25 (48%) Frame = +2 Query: 332 DYRVVVTLSTFGNFLFQHYLLRTII 406 DY + GNF F H L+ ++ Sbjct: 90 DYSSAEHFTALGNFYFVHESLKNVL 114 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,572 Number of Sequences: 438 Number of extensions: 3484 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20343105 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -