BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31179 (479 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5773| Best HMM Match : HA2 (HMM E-Value=3e-16) 33 0.092 SB_27756| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_35683| Best HMM Match : Amino_oxidase (HMM E-Value=0.0092) 27 8.0 >SB_5773| Best HMM Match : HA2 (HMM E-Value=3e-16) Length = 2352 Score = 33.5 bits (73), Expect = 0.092 Identities = 23/63 (36%), Positives = 28/63 (44%), Gaps = 1/63 (1%) Frame = +1 Query: 55 LHGSVLPMDWVKSLS-FPGTRLFELATSRLSTPFTIHLPKEAMTTSCTARKNYEEIRFLD 231 LHG +L D K FPG R +T+ T TI K + T YEE R L+ Sbjct: 942 LHGKLLQEDQQKVFQQFPGKRKVVFSTNCAETSITIPGVKFVVDTGMAKEMKYEEKRGLN 1001 Query: 232 IYE 240 I E Sbjct: 1002 ILE 1004 >SB_27756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 520 Score = 27.9 bits (59), Expect = 4.6 Identities = 14/45 (31%), Positives = 18/45 (40%) Frame = +3 Query: 93 PEFSWYSPLRTGYLPPFNSFYYPFAQRSNDYELHSEEELRRNSLP 227 P + Y P Y PP+ S Y P Q+ ND +N P Sbjct: 477 PPYKSYQPPYKSYQPPYKS-YQPLHQQRNDQITEPSRPSHKNIQP 520 >SB_35683| Best HMM Match : Amino_oxidase (HMM E-Value=0.0092) Length = 729 Score = 27.1 bits (57), Expect = 8.0 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +1 Query: 322 NFVGNYWQTNADLFEEDLLQFYQRSYEVNA-RRVLGAAAKPLNQYT 456 N G WQ+ ADL F R ++N +++L A+K +Y+ Sbjct: 249 NGTGGIWQSVADLLPRSWFHFENRVVQLNIDKKILTVASKDGAKYS 294 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,212,339 Number of Sequences: 59808 Number of extensions: 234931 Number of successful extensions: 515 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 494 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 514 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1001731762 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -