BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31179 (479 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68014-6|CAA92029.1| 279|Caenorhabditis elegans Hypothetical pr... 29 1.7 AL021175-4|CAA15971.1| 356|Caenorhabditis elegans Hypothetical ... 28 4.0 AJ512486-1|CAD54736.1| 559|Caenorhabditis elegans core alpha-6-... 27 7.0 AF022968-8|AAN84870.1| 559|Caenorhabditis elegans Fucosyl trans... 27 7.0 >Z68014-6|CAA92029.1| 279|Caenorhabditis elegans Hypothetical protein W04G3.7 protein. Length = 279 Score = 29.1 bits (62), Expect = 1.7 Identities = 16/53 (30%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = +3 Query: 60 WERLTNGLGKIPEFSWYSPLRTGYLP-PFNSFYYPFAQRSNDYELHSEEELRR 215 W++ TN +F+ P T P N + QR ++EL E+E RR Sbjct: 195 WQKFTNQNSWSSQFTIKPPTTTTTTESPLNYYLELLHQREREFELRKEQEARR 247 >AL021175-4|CAA15971.1| 356|Caenorhabditis elegans Hypothetical protein Y6E2A.5 protein. Length = 356 Score = 27.9 bits (59), Expect = 4.0 Identities = 20/88 (22%), Positives = 41/88 (46%), Gaps = 4/88 (4%) Frame = +1 Query: 79 DWVKSLSFPGTRL---FELATSRLSTPFTIHLPKEAMTTSCTARKNYEEIRF-LDIYEKT 246 DW+K P R+ F + +S+ +EA+ A++ Y + F ++ ++ Sbjct: 204 DWLKDTRAPLIRIKTKFTMFSSKWRRTDEDENKEEALYIQNLAQEAYYTLVFDFEMLQEL 263 Query: 247 FFQYLXQGHFKAFDKEIDLHSSKAVNFV 330 ++YL + K K+I ++K NF+ Sbjct: 264 AYKYLDKLFLKVLQKQISQVATKLCNFI 291 >AJ512486-1|CAD54736.1| 559|Caenorhabditis elegans core alpha-6-fucosyltransferase protein. Length = 559 Score = 27.1 bits (57), Expect = 7.0 Identities = 14/47 (29%), Positives = 21/47 (44%), Gaps = 5/47 (10%) Frame = +1 Query: 265 QGHFKAFDKEIDLHSSKAVNFVGNYWQ-----TNADLFEEDLLQFYQ 390 + H +KEIDL V GN+W TN ++E + Y+ Sbjct: 498 EDHIAQNNKEIDLKVGDKVGIAGNHWNGYSKGTNRQTYKEGVFPSYK 544 >AF022968-8|AAN84870.1| 559|Caenorhabditis elegans Fucosyl transferase protein 8 protein. Length = 559 Score = 27.1 bits (57), Expect = 7.0 Identities = 14/47 (29%), Positives = 21/47 (44%), Gaps = 5/47 (10%) Frame = +1 Query: 265 QGHFKAFDKEIDLHSSKAVNFVGNYWQ-----TNADLFEEDLLQFYQ 390 + H +KEIDL V GN+W TN ++E + Y+ Sbjct: 498 EDHIAQNNKEIDLKVGDKVGIAGNHWNGYSKGTNRQTYKEGVFPSYK 544 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,885,337 Number of Sequences: 27780 Number of extensions: 183577 Number of successful extensions: 488 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 480 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 488 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 882200194 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -