BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31176 (455 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 26 0.17 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 24 0.68 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 24 0.90 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 23 1.2 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 23 1.2 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 23 1.2 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 23 1.2 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 23 1.2 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 23 1.2 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 23 1.2 DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 23 1.2 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 23 1.2 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 23 1.6 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 23 1.6 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 23 1.6 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 23 1.6 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 23 1.6 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 23 1.6 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 23 1.6 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 23 1.6 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 23 1.6 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 23 1.6 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 23 1.6 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 23 1.6 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 23 2.1 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 23 2.1 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 23 2.1 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 23 2.1 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 23 2.1 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 23 2.1 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 23 2.1 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 22 2.7 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 22 2.7 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 22 2.7 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 22 2.7 DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 22 2.7 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 22 2.7 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 22 2.7 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 22 2.7 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 22 2.7 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 22 2.7 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 22 2.7 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 22 2.7 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 22 2.7 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 22 2.7 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 22 2.7 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 22 3.6 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 22 3.6 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 22 3.6 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 22 3.6 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 22 3.6 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 22 3.6 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 22 3.6 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 22 3.6 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 22 3.6 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 22 3.6 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 22 3.6 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 22 3.6 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 22 3.6 DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 22 3.6 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 3.6 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 3.6 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 3.6 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 3.6 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 22 3.6 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 22 3.6 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 3.6 AB083209-1|BAC54133.1| 87|Apis mellifera hypothetical protein ... 22 3.6 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 21 4.8 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 21 4.8 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 21 6.3 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 21 6.3 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 21 6.3 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 21 6.3 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 21 8.4 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 26.2 bits (55), Expect = 0.17 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 450 DRLKPAYITRDDGKREDKQKPSE 382 DR K + R+D E+ QKP E Sbjct: 129 DRRKKTFAAREDNDEEEAQKPKE 151 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 24.2 bits (50), Expect = 0.68 Identities = 16/52 (30%), Positives = 25/52 (48%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRSYRSRRG 282 LH E RE+T+R R++ + + E + T+ +RS R RRG Sbjct: 270 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERS-RDRRG 320 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 23.8 bits (49), Expect = 0.90 Identities = 16/70 (22%), Positives = 33/70 (47%), Gaps = 6/70 (8%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRS------YRSRRGST 276 LH +E + E+T+R R++ + + E + + T+ +RS RS+ Sbjct: 260 LHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERSRDKTERERSKERKI 319 Query: 275 VASSCHGYLS 246 ++S + Y+S Sbjct: 320 ISSLSNNYIS 329 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 1.2 Identities = 12/46 (26%), Positives = 22/46 (47%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRS 300 LH +E + E+T+R+ R++ + E Q T+ +RS Sbjct: 22 LHNEKEKLLEERTSRNRYSRSREREQNSYKNEREYQKYRETSKERS 67 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 1.2 Identities = 12/46 (26%), Positives = 22/46 (47%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRS 300 LH +E + E+T+R+ R++ + E Q T+ +RS Sbjct: 22 LHNEKEKLLEERTSRNRYSRSREREQNSYKNEREYQKYRETSKERS 67 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 1.2 Identities = 12/46 (26%), Positives = 22/46 (47%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRS 300 LH +E + E+T+R+ R++ + E Q T+ +RS Sbjct: 22 LHNEKEKLLEERTSRNRYSRSREREQNSYKNEREYQKYRETSKERS 67 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 1.2 Identities = 12/46 (26%), Positives = 22/46 (47%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRS 300 LH +E + E+T+R+ R++ + E Q T+ +RS Sbjct: 22 LHNEKEKLLEERTSRNRYSRSREREQNSYKNEREYQKYRETSKERS 67 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 1.2 Identities = 12/46 (26%), Positives = 22/46 (47%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRS 300 LH +E + E+T+R+ R++ + E Q T+ +RS Sbjct: 22 LHNEKEKLLEERTSRNRYSRSREREQNSYKNEREYQKYRETSKERS 67 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 1.2 Identities = 12/46 (26%), Positives = 22/46 (47%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRS 300 LH +E + E+T+R+ R++ + E Q T+ +RS Sbjct: 22 LHNEKEKLLEERTSRNRYSRSREREQNSYKNEREYQKYRETSKERS 67 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 1.2 Identities = 12/46 (26%), Positives = 22/46 (47%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRS 300 LH +E + E+T+R+ R++ + E Q T+ +RS Sbjct: 22 LHNEKEKLLEERTSRNRYSRSREREQNSYKNEREYQKYRETSKERS 67 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.4 bits (48), Expect = 1.2 Identities = 12/46 (26%), Positives = 21/46 (45%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRS 300 LH +E + E+TNR R++ + E + T+ +RS Sbjct: 21 LHNEKEKLLEERTNRKRNSRSREREQNSYKNEREYRKYRETSKERS 66 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.4 bits (48), Expect = 1.2 Identities = 12/46 (26%), Positives = 21/46 (45%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRS 300 LH +E + E+TNR R++ + E + T+ +RS Sbjct: 21 LHNEKEKLLEERTNRKRNSRSREREQNSYKNEREYRKYRETSKERS 66 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.0 bits (47), Expect = 1.6 Identities = 14/51 (27%), Positives = 24/51 (47%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRSYRSRR 285 LH +E + E+T+R R++ + E + T+ +RS R RR Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKERS-RDRR 71 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 23.0 bits (47), Expect = 1.6 Identities = 14/51 (27%), Positives = 24/51 (47%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRSYRSRR 285 LH +E + E+T+R R++ + E + T+ +RS R RR Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKERS-RDRR 71 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.0 bits (47), Expect = 1.6 Identities = 14/51 (27%), Positives = 24/51 (47%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRSYRSRR 285 LH +E + E+T+R R++ + E + T+ +RS R RR Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKERS-RDRR 71 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.0 bits (47), Expect = 1.6 Identities = 14/51 (27%), Positives = 24/51 (47%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRSYRSRR 285 LH +E + E+T+R R++ + E + T+ +RS R RR Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKERS-RDRR 71 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.0 bits (47), Expect = 1.6 Identities = 14/51 (27%), Positives = 24/51 (47%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRSYRSRR 285 LH +E + E+T+R R++ + E + T+ +RS R RR Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKERS-RDRR 71 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.0 bits (47), Expect = 1.6 Identities = 14/51 (27%), Positives = 24/51 (47%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRSYRSRR 285 LH +E + E+T+R R++ + E + T+ +RS R RR Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKERS-RDRR 71 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.0 bits (47), Expect = 1.6 Identities = 14/51 (27%), Positives = 24/51 (47%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRSYRSRR 285 LH +E + E+T+R R++ + E + T+ +RS R RR Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKERS-RDRR 71 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.0 bits (47), Expect = 1.6 Identities = 14/51 (27%), Positives = 24/51 (47%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRSYRSRR 285 LH +E + E+T+R R++ + E + T+ +RS R RR Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKERS-RDRR 71 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 23.0 bits (47), Expect = 1.6 Identities = 14/51 (27%), Positives = 24/51 (47%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRSYRSRR 285 LH +E + E+T+R R++ + E + T+ +RS R RR Sbjct: 244 LHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKERS-RDRR 293 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 23.0 bits (47), Expect = 1.6 Identities = 18/66 (27%), Positives = 31/66 (46%), Gaps = 4/66 (6%) Frame = -1 Query: 437 LHISRETMAREKTNR---SPARRAKNISVQYKRREAAVQSPSR-TTIDRSYRSRRGSTVA 270 LH +E + E+T+R S +R + S + +R + S+ + DR+ R R T Sbjct: 244 LHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKGRSRDRTERERSKETKI 303 Query: 269 SSCHGY 252 S + Y Sbjct: 304 ISSNNY 309 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.0 bits (47), Expect = 1.6 Identities = 18/66 (27%), Positives = 31/66 (46%), Gaps = 4/66 (6%) Frame = -1 Query: 437 LHISRETMAREKTNR---SPARRAKNISVQYKRREAAVQSPSR-TTIDRSYRSRRGSTVA 270 LH +E + E+T+R S +R + S + +R + S+ + DR+ R R T Sbjct: 255 LHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKGRSRDRTERERSKETKI 314 Query: 269 SSCHGY 252 S + Y Sbjct: 315 ISSNNY 320 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 23.0 bits (47), Expect = 1.6 Identities = 11/46 (23%), Positives = 23/46 (50%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRS 300 LH +E + E+T+R R++ + + E + +T+ +RS Sbjct: 244 LHNEKEKLLEERTSRKRYSRSREREQKSYKNEREYRKYGKTSKERS 289 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 22.6 bits (46), Expect = 2.1 Identities = 13/51 (25%), Positives = 26/51 (50%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRSYRSRR 285 LH +E + E+T+R R++ + + E + + T+ +RS R R+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREKKSYKNENSYRKYRETSKERS-RDRK 71 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 22.6 bits (46), Expect = 2.1 Identities = 13/51 (25%), Positives = 26/51 (50%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRSYRSRR 285 LH +E + E+T+R R++ + + E + + T+ +RS R R+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREKKSYKNENSYRKYRETSKERS-RDRK 71 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 22.6 bits (46), Expect = 2.1 Identities = 13/51 (25%), Positives = 26/51 (50%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRSYRSRR 285 LH +E + E+T+R R++ + + E + + T+ +RS R R+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREKKSYKNENSYRKYRETSKERS-RDRK 71 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 22.6 bits (46), Expect = 2.1 Identities = 13/51 (25%), Positives = 26/51 (50%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRSYRSRR 285 LH +E + E+T+R R++ + + E + + T+ +RS R R+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREKKSYKNENSYRKYRETSKERS-RDRK 71 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 22.6 bits (46), Expect = 2.1 Identities = 13/51 (25%), Positives = 26/51 (50%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRSYRSRR 285 LH +E + E+T+R R++ + + E + + T+ +RS R R+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERS-RDRK 71 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 22.6 bits (46), Expect = 2.1 Identities = 13/51 (25%), Positives = 26/51 (50%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRSYRSRR 285 LH +E + E+T+R R++ + + E + + T+ +RS R R+ Sbjct: 255 LHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERS-RDRK 304 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 22.6 bits (46), Expect = 2.1 Identities = 13/51 (25%), Positives = 26/51 (50%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRSYRSRR 285 LH +E + E+T+R R++ + + E + + T+ +RS R R+ Sbjct: 255 LHNEKEKLLEERTSRKRYSRSREREKKSYKNENSYRKYRETSKERS-RDRK 304 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 22.2 bits (45), Expect = 2.7 Identities = 11/46 (23%), Positives = 23/46 (50%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRS 300 LH +E E+T+R R++ + + E + + +T+ +RS Sbjct: 22 LHNEKEKFLEERTSRKRYSRSREREQKSYKNENSYRKYRKTSKERS 67 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 22.2 bits (45), Expect = 2.7 Identities = 11/46 (23%), Positives = 23/46 (50%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRS 300 LH +E E+T+R R++ + + E + + +T+ +RS Sbjct: 22 LHNEKEKFLEERTSRKRYSRSREREQKSYKNENSYRKYRKTSKERS 67 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 22.2 bits (45), Expect = 2.7 Identities = 11/46 (23%), Positives = 23/46 (50%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRS 300 LH +E E+T+R R++ + + E + + +T+ +RS Sbjct: 22 LHNEKEKFLEERTSRKRYSRSREREQKSYKNENSYRKYRKTSKERS 67 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 22.2 bits (45), Expect = 2.7 Identities = 11/46 (23%), Positives = 23/46 (50%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRS 300 LH +E E+T+R R++ + + E + + +T+ +RS Sbjct: 22 LHNEKEKFLEERTSRKRYSRSREREQKSYKNENSYRKYRKTSKERS 67 >DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 22.2 bits (45), Expect = 2.7 Identities = 11/46 (23%), Positives = 23/46 (50%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRS 300 LH +E E+T+R R++ + + E + + +T+ +RS Sbjct: 22 LHNEKEKFLEERTSRKRYSRSREREQKSYKNENSYRKYRKTSKERS 67 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 22.2 bits (45), Expect = 2.7 Identities = 11/46 (23%), Positives = 23/46 (50%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRS 300 LH +E E+T+R R++ + + E + + +T+ +RS Sbjct: 22 LHNEKEKFLEERTSRKRYSRSREREQKSYKNENSYRKYRKTSKERS 67 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.2 bits (45), Expect = 2.7 Identities = 11/46 (23%), Positives = 23/46 (50%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRS 300 LH +E + E+T+R R++ + + E + + T+ +RS Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERS 67 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 22.2 bits (45), Expect = 2.7 Identities = 11/46 (23%), Positives = 23/46 (50%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRS 300 LH +E + E+T+R R++ + + E + + T+ +RS Sbjct: 255 LHNEKEKLLEERTSRKRYSRSREREQRSYKNENSYRKYRETSKERS 300 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 22.2 bits (45), Expect = 2.7 Identities = 11/46 (23%), Positives = 23/46 (50%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRS 300 LH +E + E+T+R R++ + + E + + T+ +RS Sbjct: 244 LHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERS 289 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.2 bits (45), Expect = 2.7 Identities = 11/46 (23%), Positives = 23/46 (50%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRS 300 LH +E + E+T+R R++ + + E + + T+ +RS Sbjct: 255 LHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERS 300 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.2 bits (45), Expect = 2.7 Identities = 11/46 (23%), Positives = 23/46 (50%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRS 300 LH +E + E+T+R R++ + + E + + T+ +RS Sbjct: 255 LHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERS 300 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 22.2 bits (45), Expect = 2.7 Identities = 11/46 (23%), Positives = 23/46 (50%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRS 300 LH +E + E+T+R R++ + + E + + T+ +RS Sbjct: 244 LHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERS 289 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 22.2 bits (45), Expect = 2.7 Identities = 11/46 (23%), Positives = 23/46 (50%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRS 300 LH +E + E+T+R R++ + + E + + T+ +RS Sbjct: 255 LHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERS 300 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 22.2 bits (45), Expect = 2.7 Identities = 13/51 (25%), Positives = 26/51 (50%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRSYRSRR 285 LH ++ + E+T+R R++ + + E + + T+ +RS R RR Sbjct: 255 LHNEKKKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERS-RDRR 304 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 22.2 bits (45), Expect = 2.7 Identities = 11/46 (23%), Positives = 22/46 (47%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRS 300 LH +E + E+T+R R++ + + E + T+ +RS Sbjct: 255 LHNEKEKLLEERTSRERYSRSREREQKSYKNEREYRKYGETSKERS 300 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.8 bits (44), Expect = 3.6 Identities = 11/46 (23%), Positives = 22/46 (47%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRS 300 LH +E + E+T+R R++ + + E + T+ +RS Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQKSYKNEREYRKYRETSKERS 67 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.8 bits (44), Expect = 3.6 Identities = 11/46 (23%), Positives = 22/46 (47%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRS 300 LH +E + E+T+R R++ + + E + T+ +RS Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQKSYKNEREYRKYRETSKERS 67 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 3.6 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRSYRSRR 285 LH +E + E+T+R R++ + E + T+ +RS R R+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKERS-RDRK 71 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 3.6 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRSYRSRR 285 LH +E + E+T+R R++ + E + T+ +RS R R+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKERS-RDRK 71 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 3.6 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRSYRSRR 285 LH +E + E+T+R R++ + E + T+ +RS R R+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKERS-RDRK 71 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 21.8 bits (44), Expect = 3.6 Identities = 16/68 (23%), Positives = 29/68 (42%), Gaps = 6/68 (8%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRS------YRSRRGST 276 LH +E + E+T+R R++ + E + T+ +RS RSR Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKERSRDRTERERSREPKI 81 Query: 275 VASSCHGY 252 ++S + Y Sbjct: 82 ISSLSNNY 89 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 3.6 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRSYRSRR 285 LH E RE+T+R R++ + + E + T+ +RS R RR Sbjct: 22 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERS-RDRR 71 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 3.6 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRSYRSRR 285 LH E RE+T+R R++ + + E + T+ +RS R RR Sbjct: 22 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERS-RDRR 71 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 3.6 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRSYRSRR 285 LH E RE+T+R R++ + + E + T+ +RS R RR Sbjct: 22 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERS-RDRR 71 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 3.6 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRSYRSRR 285 LH E RE+T+R R++ + + E + T+ +RS R RR Sbjct: 22 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERS-RDRR 71 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 3.6 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRSYRSRR 285 LH E RE+T+R R++ + + E + T+ +RS R RR Sbjct: 22 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERS-RDRR 71 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 3.6 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRSYRSRR 285 LH E RE+T+R R++ + + E + T+ +RS R RR Sbjct: 22 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERS-RDRR 71 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 3.6 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRSYRSRR 285 LH E RE+T+R R++ + + E + T+ +RS R RR Sbjct: 22 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERS-RDRR 71 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 21.8 bits (44), Expect = 3.6 Identities = 6/25 (24%), Positives = 17/25 (68%) Frame = -1 Query: 104 IIVNSYIC*SFVLCLVNLLIICSVS 30 ++ +S++ +LC ++L +C++S Sbjct: 109 MLCDSWVSLDILLCTASILSLCAIS 133 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 3.6 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRSYRSRR 285 LH E RE+T+R R++ + + E + T+ +RS R RR Sbjct: 271 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERS-RDRR 320 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 3.6 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRSYRSRR 285 LH E RE+T+R R++ + + E + T+ +RS R RR Sbjct: 271 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERS-RDRR 320 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 3.6 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRSYRSRR 285 LH E RE+T+R R++ + + E + T+ +RS R RR Sbjct: 271 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERS-RDRR 320 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 3.6 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRSYRSRR 285 LH E RE+T+R R++ + + E + T+ +RS R RR Sbjct: 271 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERS-RDRR 320 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 3.6 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRSYRSRR 285 LH E RE+T+R R++ + + E + T+ +RS R RR Sbjct: 271 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERS-RDRR 320 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 3.6 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRSYRSRR 285 LH E RE+T+R R++ + + E + T+ +RS R RR Sbjct: 271 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERS-RDRR 320 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.8 bits (44), Expect = 3.6 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRSYRSRR 285 LH E RE+T+R R++ + + E + T+ +RS R RR Sbjct: 271 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERS-RDRR 320 >AB083209-1|BAC54133.1| 87|Apis mellifera hypothetical protein protein. Length = 87 Score = 21.8 bits (44), Expect = 3.6 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +3 Query: 297 IATVDSSPGR*LYGRFSSFVLDADVLRSPR 386 +ATV S L+ F ++ A +R PR Sbjct: 14 LATVSSQDYSQLFAGFGPYIRQAVAMRDPR 43 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 21.4 bits (43), Expect = 4.8 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +2 Query: 113 NARSVRGFVADCRRSSPASPAITRPRVGS 199 +A+ F CR SP++P+ITR + S Sbjct: 320 SAKYRNAFKETCR-CSPSNPSITRTGLSS 347 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.4 bits (43), Expect = 4.8 Identities = 11/46 (23%), Positives = 21/46 (45%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRS 300 LH +E + E+T+R R++ + E + T+ +RS Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQNSYKNEKEYRKYRETSKERS 67 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 21.0 bits (42), Expect = 6.3 Identities = 11/46 (23%), Positives = 22/46 (47%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRS 300 LH +E + E+T+R R++ + + E + + T +RS Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETWKERS 67 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.0 bits (42), Expect = 6.3 Identities = 11/46 (23%), Positives = 22/46 (47%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRS 300 LH +E + E+T+R R++ + + E + + T +RS Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETWKERS 67 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.0 bits (42), Expect = 6.3 Identities = 11/46 (23%), Positives = 22/46 (47%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRS 300 LH +E + E+T+R R++ + + E + + T +RS Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETWKERS 67 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.0 bits (42), Expect = 6.3 Identities = 11/46 (23%), Positives = 22/46 (47%) Frame = -1 Query: 437 LHISRETMAREKTNRSPARRAKNISVQYKRREAAVQSPSRTTIDRS 300 LH +E + E+T+R R++ + + E + + T +RS Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETWKERS 67 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 20.6 bits (41), Expect = 8.4 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -1 Query: 368 ISVQYKRREAAVQSPSRTTIDRSYRS 291 I+ Q R + SP++ R YRS Sbjct: 678 ITFQDVARRSVANSPTKNADSREYRS 703 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,945 Number of Sequences: 438 Number of extensions: 2784 Number of successful extensions: 76 Number of sequences better than 10.0: 75 Number of HSP's better than 10.0 without gapping: 76 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 76 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12066642 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -