BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31175 (600 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g21160.1 68418.m02528 La domain-containing protein / proline-... 34 0.063 >At5g21160.1 68418.m02528 La domain-containing protein / proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965, PF05383: La domain Length = 826 Score = 34.3 bits (75), Expect = 0.063 Identities = 24/68 (35%), Positives = 34/68 (50%), Gaps = 1/68 (1%) Frame = -1 Query: 501 SKTVGSG-LALPLALLMPTGDGNYSSGAPYTHPTEHCSEACHSERVNNFKSSNLL**FIK 325 ++T+G G P ++ GN S G+ ++ SE S R NN+KS NL + Sbjct: 368 AETIGDGDKDSPKSITSGDNFGNPSKGSSKPTVSDFSSEGAQSSRTNNYKSGNLKSSADE 427 Query: 324 KRNGCEDL 301 KRN EDL Sbjct: 428 KRN-VEDL 434 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,088,434 Number of Sequences: 28952 Number of extensions: 205440 Number of successful extensions: 374 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 368 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 374 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1187288784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -