BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31169 (607 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g26680.1 68415.m03200 expressed protein similar to NLPE1 (GI:... 28 4.2 At1g51055.1 68414.m05739 hypothetical protein 27 9.6 >At2g26680.1 68415.m03200 expressed protein similar to NLPE1 (GI:13022100) [Rhizobium etli]; Length = 319 Score = 28.3 bits (60), Expect = 4.2 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +3 Query: 537 MFLNCVFLTSLIFFFNNESL 596 + L+ +FL+SL FFF+N SL Sbjct: 23 LVLSIIFLSSLFFFFSNSSL 42 >At1g51055.1 68414.m05739 hypothetical protein Length = 161 Score = 27.1 bits (57), Expect = 9.6 Identities = 12/38 (31%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = -2 Query: 279 LWLSEPVICNQPSKWMNL-GCLMSDV*STYVLKIRLYK 169 ++L +C ++W NL C++ D VLK++LY+ Sbjct: 35 VYLDHLELCLCSTEWWNLLTCILDDAPKLRVLKLKLYR 72 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,813,356 Number of Sequences: 28952 Number of extensions: 156118 Number of successful extensions: 366 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 365 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 366 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1206913392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -