BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31167 (682 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 25 2.9 AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein... 23 8.9 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 24.6 bits (51), Expect = 2.9 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -3 Query: 593 VSIVLCTCKRLANLVLTTCLNKF 525 V V+ K + N+VL TCL +F Sbjct: 975 VQCVIVAVKTIGNIVLVTCLLQF 997 >AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein coupled receptor protein. Length = 459 Score = 23.0 bits (47), Expect = 8.9 Identities = 15/48 (31%), Positives = 22/48 (45%) Frame = -3 Query: 617 SLSKNSVPVSIVLCTCKRLANLVLTTCLNKFRIKSTVFDGHIM*TPLI 474 SL NS P+ +LC + NL + L + K G I TP++ Sbjct: 250 SLCTNSFPLGTLLCVGIVICNLSVRKVLYQSHRKMCRQFGSIKPTPML 297 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 754,884 Number of Sequences: 2352 Number of extensions: 15821 Number of successful extensions: 22 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68577420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -