BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31166 (359 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ535357-1|ABF83300.1| 127|Homo sapiens circulating B cell anti... 29 5.7 D31891-1|BAA06689.2| 1300|Homo sapiens KIAA0067 protein. 28 7.6 BC028671-1|AAH28671.1| 1290|Homo sapiens SET domain, bifurcated ... 28 7.6 AL590133-4|CAI13328.1| 1291|Homo sapiens SET domain, bifurcated ... 28 7.6 >DQ535357-1|ABF83300.1| 127|Homo sapiens circulating B cell antibody heavy chain variable region protein. Length = 127 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -1 Query: 131 RPNDLRVVLCRGGSDDGSHKGESYNDDQF 45 RP D V C GG D H+ E Y D + Sbjct: 89 RPEDTAVYYCAGGYDRSGHEAELYYFDSW 117 >D31891-1|BAA06689.2| 1300|Homo sapiens KIAA0067 protein. Length = 1300 Score = 28.3 bits (60), Expect = 7.6 Identities = 16/59 (27%), Positives = 29/59 (49%), Gaps = 4/59 (6%) Frame = +3 Query: 177 TSNGIVRSETGELKEA----LDDDNKPHVIVAVRGSYSYTNTDGKPETITYFADETGYH 341 +++G+ + G++K+A DD NK V+ +Y Y + KPE + +T H Sbjct: 1034 STSGLGIKDEGDIKQAKKEDTDDRNKMSVVTESSRNYGYNPSPVKPEGLRRPPSKTSMH 1092 >BC028671-1|AAH28671.1| 1290|Homo sapiens SET domain, bifurcated 1 protein. Length = 1290 Score = 28.3 bits (60), Expect = 7.6 Identities = 16/59 (27%), Positives = 29/59 (49%), Gaps = 4/59 (6%) Frame = +3 Query: 177 TSNGIVRSETGELKEA----LDDDNKPHVIVAVRGSYSYTNTDGKPETITYFADETGYH 341 +++G+ + G++K+A DD NK V+ +Y Y + KPE + +T H Sbjct: 1025 STSGLGIKDEGDIKQAKKEDTDDRNKMSVVTESSRNYGYNPSPVKPEGLRRPPSKTSMH 1083 >AL590133-4|CAI13328.1| 1291|Homo sapiens SET domain, bifurcated 1 protein. Length = 1291 Score = 28.3 bits (60), Expect = 7.6 Identities = 16/59 (27%), Positives = 29/59 (49%), Gaps = 4/59 (6%) Frame = +3 Query: 177 TSNGIVRSETGELKEA----LDDDNKPHVIVAVRGSYSYTNTDGKPETITYFADETGYH 341 +++G+ + G++K+A DD NK V+ +Y Y + KPE + +T H Sbjct: 1025 STSGLGIKDEGDIKQAKKEDTDDRNKMSVVTESSRNYGYNPSPVKPEGLRRPPSKTSMH 1083 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 48,709,965 Number of Sequences: 237096 Number of extensions: 881139 Number of successful extensions: 2406 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2330 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2405 length of database: 76,859,062 effective HSP length: 81 effective length of database: 57,654,286 effective search space used: 2190862868 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -