BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31159 (823 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC887.14c |pfh1|pif1|pif1 helicase homolog Pfh1|Schizosaccharo... 29 1.1 SPBP23A10.13 |orc4|orp4|origin recognition complex subunit Orc4|... 27 2.4 SPAP11E10.02c |mam3|SPAPB1A10.01c|cell agglutination protein Mam... 26 5.6 SPAC21E11.05c |cyp8||cyclophilin family peptidyl-prolyl cis-tran... 26 5.6 SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, wit... 26 7.4 SPAC25A8.03c ||SPAC3C7.15c|DUF185 protein|Schizosaccharomyces po... 26 7.4 >SPBC887.14c |pfh1|pif1|pif1 helicase homolog Pfh1|Schizosaccharomyces pombe|chr 2|||Manual Length = 805 Score = 28.7 bits (61), Expect = 1.1 Identities = 18/63 (28%), Positives = 32/63 (50%) Frame = +1 Query: 367 RSEATKTFEDETRRIRADTAALIHRARSVVPRAKSLSPLDTIYSYSYGEPIPYRFSNDAY 546 ++ +K +ED T A + + R + R+++L P + Y YG+P P R S A Sbjct: 178 KNHLSKIYEDHTSEKGASSVISSNITRQGIKRSRTL-PW-AVDPYRYGDPDPKRTSTSAD 235 Query: 547 IAK 555 I++ Sbjct: 236 ISQ 238 >SPBP23A10.13 |orc4|orp4|origin recognition complex subunit Orc4|Schizosaccharomyces pombe|chr 2|||Manual Length = 972 Score = 27.5 bits (58), Expect = 2.4 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +2 Query: 704 QGAQHQG*REPALVLPEKKARGRP 775 +G+ Q P +VLP K+ RGRP Sbjct: 214 EGSSSQNGLSPLVVLPAKRGRGRP 237 >SPAP11E10.02c |mam3|SPAPB1A10.01c|cell agglutination protein Mam3|Schizosaccharomyces pombe|chr 1|||Manual Length = 1082 Score = 26.2 bits (55), Expect = 5.6 Identities = 22/58 (37%), Positives = 29/58 (50%), Gaps = 2/58 (3%) Frame = +2 Query: 482 STPSTHIHTANRSRTVSAMTLTLLSFWCPYAASGI--ASTIFPSITSQPRSSLDAATS 649 STPST I T+N S VS T + L P +S + ST P++T S + TS Sbjct: 538 STPSTTIPTSNSS--VSLQTSSSLIISSPIISSSLTATSTSTPALTHSITPSNTSYTS 593 >SPAC21E11.05c |cyp8||cyclophilin family peptidyl-prolyl cis-trans isomerase Cyp8|Schizosaccharomyces pombe|chr 1|||Manual Length = 516 Score = 26.2 bits (55), Expect = 5.6 Identities = 17/58 (29%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Frame = +2 Query: 458 RAPSPYHHSTPSTHIHTANRSRTVSA-MTLTLLSFWCPYAASGIASTIFPSITSQPRS 628 RA S S+P H+ + S+++++ M + S YAA+ + ST F +T R+ Sbjct: 202 RAKSTESTSSPELS-HSLDSSKSIASDMPIHRASHTTGYAAASLTSTSFTPVTKNERA 258 >SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, with EF hand and WH2 motif |Schizosaccharomyces pombe|chr 1|||Manual Length = 1794 Score = 25.8 bits (54), Expect = 7.4 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +2 Query: 593 TIFPSITSQPRSSLDAATSRACTTPVKKGFF 685 ++ PS+ QP SS+ AT+ + T P + F Sbjct: 1496 SMIPSVAQQPPSSVAPATAPSSTLPPSQSSF 1526 >SPAC25A8.03c ||SPAC3C7.15c|DUF185 protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 467 Score = 25.8 bits (54), Expect = 7.4 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -2 Query: 822 LAFQGTSLTVHSGGPDGRPRAFFSG 748 LAFQ + V G D R + +FSG Sbjct: 287 LAFQQARINVQQGFSDSRAKRYFSG 311 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,214,523 Number of Sequences: 5004 Number of extensions: 64611 Number of successful extensions: 189 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 185 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 189 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 402440190 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -