BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31158 (669 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y17702-1|CAA76822.2| 260|Anopheles gambiae putative gVAG protei... 25 1.6 AJ441131-1|CAD29630.1| 567|Anopheles gambiae putative chitin bi... 25 1.6 AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin b... 25 1.6 AF457548-1|AAL68778.1| 178|Anopheles gambiae antigen 5-related ... 25 1.6 AY341160-1|AAR13724.1| 159|Anopheles gambiae CED6 protein. 23 6.6 AY341159-1|AAR13723.1| 159|Anopheles gambiae CED6 protein. 23 6.6 AY341158-1|AAR13722.1| 159|Anopheles gambiae CED6 protein. 23 6.6 AY341157-1|AAR13721.1| 159|Anopheles gambiae CED6 protein. 23 6.6 AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. 23 6.6 AY341161-1|AAR13725.1| 159|Anopheles gambiae CED6 protein. 23 8.7 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 23 8.7 AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical prot... 23 8.7 >Y17702-1|CAA76822.2| 260|Anopheles gambiae putative gVAG protein precursor protein. Length = 260 Score = 25.4 bits (53), Expect = 1.6 Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 3/49 (6%) Frame = -1 Query: 273 SGQSYELGEFQTTRFVGVDLLNKFLEDFLVEWL---PHHSQDISHEVTG 136 +GQ+ + +F RF DL++KF+ + E+L P H + +G Sbjct: 130 AGQNIAITQFFGYRFTEKDLIHKFVSSWWSEYLDARPEHVRKYPSSYSG 178 >AJ441131-1|CAD29630.1| 567|Anopheles gambiae putative chitin binding protein protein. Length = 567 Score = 25.4 bits (53), Expect = 1.6 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = -1 Query: 489 HELVEVDGAASVSVDLLDEAIEFIVSQLLVQFPEDLAQA 373 H + E+ AA+VSV+++ EAI +L Q + QA Sbjct: 274 HTVEELAAAANVSVEVIKEAIRVRQQELRAQKQYEKQQA 312 >AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin binding protein protein. Length = 568 Score = 25.4 bits (53), Expect = 1.6 Identities = 15/39 (38%), Positives = 25/39 (64%) Frame = -1 Query: 489 HELVEVDGAASVSVDLLDEAIEFIVSQLLVQFPEDLAQA 373 H + E+ AA+VSV+++ EAI V Q ++ PE + +A Sbjct: 281 HTVEELAAAANVSVEVIKEAIR--VRQQELRGPEAVREA 317 >AF457548-1|AAL68778.1| 178|Anopheles gambiae antigen 5-related 1 protein protein. Length = 178 Score = 25.4 bits (53), Expect = 1.6 Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 3/49 (6%) Frame = -1 Query: 273 SGQSYELGEFQTTRFVGVDLLNKFLEDFLVEWL---PHHSQDISHEVTG 136 +GQ+ + +F RF DL++KF+ + E+L P H + +G Sbjct: 130 AGQNIAITQFFGYRFTEKDLIHKFVSSWWSEYLDARPEHVRKYPSSYSG 178 >AY341160-1|AAR13724.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 23.4 bits (48), Expect = 6.6 Identities = 13/47 (27%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +1 Query: 241 LEFPEFVTLAAKFIVEEDAE-AMQKELREAFRLYDKEGNGYIPTSSL 378 ++ P +T+ +F + + + A +K +++ F K G G PTSS+ Sbjct: 54 IQEPRSLTIMHQFPLHKISYCADEKGVKKFFSFIAKTGTGVTPTSSI 100 >AY341159-1|AAR13723.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 23.4 bits (48), Expect = 6.6 Identities = 13/47 (27%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +1 Query: 241 LEFPEFVTLAAKFIVEEDAE-AMQKELREAFRLYDKEGNGYIPTSSL 378 ++ P +T+ +F + + + A +K +++ F K G G PTSS+ Sbjct: 54 IQEPRSLTIMHQFPLHKISYCADEKGVKKFFSFIAKTGTGVTPTSSI 100 >AY341158-1|AAR13722.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 23.4 bits (48), Expect = 6.6 Identities = 13/47 (27%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +1 Query: 241 LEFPEFVTLAAKFIVEEDAE-AMQKELREAFRLYDKEGNGYIPTSSL 378 ++ P +T+ +F + + + A +K +++ F K G G PTSS+ Sbjct: 54 IQEPRSLTIMHQFPLHKISYCADEKGVKKFFSFIAKTGTGVTPTSSI 100 >AY341157-1|AAR13721.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 23.4 bits (48), Expect = 6.6 Identities = 13/47 (27%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +1 Query: 241 LEFPEFVTLAAKFIVEEDAE-AMQKELREAFRLYDKEGNGYIPTSSL 378 ++ P +T+ +F + + + A +K +++ F K G G PTSS+ Sbjct: 54 IQEPRSLTIMHQFPLHKISYCADEKGVKKFFSFIAKTGTGVTPTSSI 100 >AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. Length = 1152 Score = 23.4 bits (48), Expect = 6.6 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +1 Query: 28 PWFWDTEDWADELPPE 75 PWFWD +A PP+ Sbjct: 1021 PWFWDKLRFAMPHPPK 1036 >AY341161-1|AAR13725.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/47 (27%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +1 Query: 241 LEFPEFVTLAAKFIVEEDAE-AMQKELREAFRLYDKEGNGYIPTSSL 378 ++ P +T+ +F + + + A +K +++ F K G G PTSS+ Sbjct: 54 IQEPRSLTIMHQFPLHKISYCADEKGVKKFFSFIAKTGTGATPTSSI 100 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +2 Query: 386 SSGNWTSS*LTMNSMASSKRSTLTEAAPSTSTSS 487 SSGNW++S + + S+ +T T P +S SS Sbjct: 488 SSGNWSASSESGRTSIGSEITT-TNTHPKSSASS 520 >AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical protein protein. Length = 765 Score = 23.0 bits (47), Expect = 8.7 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +2 Query: 386 SSGNWTSS*LTMNSMASSKRSTLTEAAPSTSTSS 487 SSGNW++S + + S+ +T T P +S SS Sbjct: 489 SSGNWSASSESGRTSIGSEITT-TNTHPKSSASS 521 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 582,620 Number of Sequences: 2352 Number of extensions: 9969 Number of successful extensions: 26 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66904800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -