BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31150 (647 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF026212-4|AAF99973.2| 386|Caenorhabditis elegans Hypothetical ... 29 2.8 Z48783-2|CAC42295.1| 805|Caenorhabditis elegans Hypothetical pr... 28 6.6 Z48783-1|CAA88701.1| 780|Caenorhabditis elegans Hypothetical pr... 28 6.6 AF233652-1|AAF63475.1| 780|Caenorhabditis elegans RFX-type tran... 28 6.6 AF226156-1|AAF61564.1| 805|Caenorhabditis elegans RFX-like tran... 28 6.6 Z72504-5|CAA96602.2| 812|Caenorhabditis elegans Hypothetical pr... 27 8.7 U58753-8|AAC24439.1| 633|Caenorhabditis elegans Hypothetical pr... 27 8.7 U58753-7|AAC24433.1| 581|Caenorhabditis elegans Hypothetical pr... 27 8.7 U41021-9|AAQ81276.1| 408|Caenorhabditis elegans Temporarily ass... 27 8.7 U41021-8|AAQ81275.1| 406|Caenorhabditis elegans Temporarily ass... 27 8.7 >AF026212-4|AAF99973.2| 386|Caenorhabditis elegans Hypothetical protein F52G3.5 protein. Length = 386 Score = 29.1 bits (62), Expect = 2.8 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = +3 Query: 354 TTTCTRPRTRFSL-KKPARSRTLAPKTKASRSRDSTNTLAPT 476 TTT P T KK ++R+ PKT + + +T T APT Sbjct: 195 TTTTEEPSTTSEYRKKSKKNRSKRPKTTKTTTTSTTTTEAPT 236 >Z48783-2|CAC42295.1| 805|Caenorhabditis elegans Hypothetical protein F33H1.1b protein. Length = 805 Score = 27.9 bits (59), Expect = 6.6 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +2 Query: 284 PSGAGYDYKYGIIRYDNDVAPEGYHYLYETEN 379 P+G ++ Y I Y N V P G + LY ++ Sbjct: 178 PNGTREEFDYNQIEYGNAVTPNGTYTLYAPDS 209 >Z48783-1|CAA88701.1| 780|Caenorhabditis elegans Hypothetical protein F33H1.1a protein. Length = 780 Score = 27.9 bits (59), Expect = 6.6 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +2 Query: 284 PSGAGYDYKYGIIRYDNDVAPEGYHYLYETEN 379 P+G ++ Y I Y N V P G + LY ++ Sbjct: 153 PNGTREEFDYNQIEYGNAVTPNGTYTLYAPDS 184 >AF233652-1|AAF63475.1| 780|Caenorhabditis elegans RFX-type transcription factor DAF-19 short variant protein. Length = 780 Score = 27.9 bits (59), Expect = 6.6 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +2 Query: 284 PSGAGYDYKYGIIRYDNDVAPEGYHYLYETEN 379 P+G ++ Y I Y N V P G + LY ++ Sbjct: 153 PNGTREEFDYNQIEYGNAVTPNGTYTLYAPDS 184 >AF226156-1|AAF61564.1| 805|Caenorhabditis elegans RFX-like transcription factor DAF-19 protein. Length = 805 Score = 27.9 bits (59), Expect = 6.6 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +2 Query: 284 PSGAGYDYKYGIIRYDNDVAPEGYHYLYETEN 379 P+G ++ Y I Y N V P G + LY ++ Sbjct: 178 PNGTREEFDYNQIEYGNAVTPNGTYTLYAPDS 209 >Z72504-5|CAA96602.2| 812|Caenorhabditis elegans Hypothetical protein C29E6.1a protein. Length = 812 Score = 27.5 bits (58), Expect = 8.7 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = +3 Query: 348 KATTTCTRPRTRFSLKKPARSRTLAPKTKASRSRDSTNTLAPTV 479 + TTT +P T S KK + T P K S+ +T T +P V Sbjct: 375 QVTTTTKKPSTTTSTKKLTTTTTTTP--KPSQKPTTTTTKSPVV 416 >U58753-8|AAC24439.1| 633|Caenorhabditis elegans Hypothetical protein W03B1.9 protein. Length = 633 Score = 27.5 bits (58), Expect = 8.7 Identities = 16/42 (38%), Positives = 20/42 (47%) Frame = +2 Query: 491 VDYTADENGFVADGAHIPK*I*SRSIF*GYFRKKKKKNSRGG 616 +D D+N F +PK + IF YF KKKKN G Sbjct: 257 MDQYDDDNFFSQTRHFLPKNLKILVIFGNYFPMKKKKNQLSG 298 >U58753-7|AAC24433.1| 581|Caenorhabditis elegans Hypothetical protein W03B1.5 protein. Length = 581 Score = 27.5 bits (58), Expect = 8.7 Identities = 16/42 (38%), Positives = 20/42 (47%) Frame = +2 Query: 491 VDYTADENGFVADGAHIPK*I*SRSIF*GYFRKKKKKNSRGG 616 +D D+N F +PK + IF YF KKKKN G Sbjct: 205 MDQYDDDNFFSQTRHFLPKNLKILVIFGNYFPMKKKKNQLSG 246 >U41021-9|AAQ81276.1| 408|Caenorhabditis elegans Temporarily assigned gene nameprotein 24, isoform b protein. Length = 408 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -2 Query: 637 IGRIGYRAPPRVFFFFF 587 IG G+ APP VF FFF Sbjct: 348 IGAFGHEAPPLVFKFFF 364 >U41021-8|AAQ81275.1| 406|Caenorhabditis elegans Temporarily assigned gene nameprotein 24, isoform a protein. Length = 406 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -2 Query: 637 IGRIGYRAPPRVFFFFF 587 IG G+ APP VF FFF Sbjct: 346 IGAFGHEAPPLVFKFFF 362 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,305,286 Number of Sequences: 27780 Number of extensions: 197449 Number of successful extensions: 738 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 714 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 735 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1434198608 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -