BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31149 (783 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 44 2e-06 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 26 0.45 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 24 1.8 AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 22 7.4 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 7.4 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 22 7.4 AF134817-1|AAD40233.1| 105|Apis mellifera FABP-like protein pro... 21 9.8 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 9.8 AB083011-1|BAC54132.1| 135|Apis mellifera fatty acid binding pr... 21 9.8 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 44.0 bits (99), Expect = 2e-06 Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Frame = +3 Query: 357 PCLKVHCSAGRVCEINEHGD-AMCNCIKDCPYETDSRRMVCTNFNETWQSDCEVYRQRC 530 PC +C G+ CE++ + A+C C++ CP R VC + + + + CE++R C Sbjct: 81 PCASKYCGIGKECELSPNSTIAVCVCMRKCPRR---HRPVCASNGKIYANHCELHRAAC 136 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 25.8 bits (54), Expect = 0.45 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +3 Query: 387 RVCEINEHGDAMCNCIKDCPYETDSRRMVCTNFNET 494 +VC H D+ C C+ DS V NFNE+ Sbjct: 344 QVCRSRRHSDSCCLCL-------DSMNAVIRNFNES 372 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 23.8 bits (49), Expect = 1.8 Identities = 10/33 (30%), Positives = 14/33 (42%) Frame = +3 Query: 378 SAGRVCEINEHGDAMCNCIKDCPYETDSRRMVC 476 + G C EH + DC E +RR +C Sbjct: 296 TTGTKCVSGEHLSVSGGALNDCHAEVVARRCLC 328 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.8 bits (44), Expect = 7.4 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -2 Query: 707 LSTFSHVAHDVKKPVPHATGEVRH 636 +++FSH + DVK + ATG H Sbjct: 276 IASFSHRSIDVKDGIVLATGITVH 299 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.8 bits (44), Expect = 7.4 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 588 EYYGTCREMPDCTESEMSDFPRRMRD 665 +Y + MPD E+E+SD +RD Sbjct: 74 QYARVQQSMPDGWETEISDQMLELRD 99 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.8 bits (44), Expect = 7.4 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -2 Query: 707 LSTFSHVAHDVKKPVPHATGEVRH 636 +++FSH + DVK + ATG H Sbjct: 276 IASFSHRSIDVKDGIVLATGITVH 299 >AF134817-1|AAD40233.1| 105|Apis mellifera FABP-like protein protein. Length = 105 Score = 21.4 bits (43), Expect = 9.8 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -3 Query: 562 PRH*SELSRHKHRWRYTSQS 503 PR ELS++ W +TS S Sbjct: 33 PRPSFELSKNGDEWTFTSSS 52 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.4 bits (43), Expect = 9.8 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -1 Query: 222 QPPRCPRGR 196 QPP+CPR R Sbjct: 564 QPPQCPRFR 572 >AB083011-1|BAC54132.1| 135|Apis mellifera fatty acid binding protein protein. Length = 135 Score = 21.4 bits (43), Expect = 9.8 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -3 Query: 562 PRH*SELSRHKHRWRYTSQS 503 PR ELS++ W +TS S Sbjct: 35 PRPSFELSKNGDEWTFTSSS 54 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 208,256 Number of Sequences: 438 Number of extensions: 4185 Number of successful extensions: 10 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24639531 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -