BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31149 (783 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g48650.1 68414.m05445 helicase domain-containing protein cont... 29 3.5 At4g21800.2 68417.m03154 ATP-binding family protein contains Pfa... 28 8.0 At4g21800.1 68417.m03153 ATP-binding family protein contains Pfa... 28 8.0 At2g26350.1 68415.m03163 zinc-binding peroxisomal integral membr... 28 8.0 >At1g48650.1 68414.m05445 helicase domain-containing protein contains similarity to DEIH-box RNA/DNA helicase [Arabidopsis thaliana] GI:5881579; contains Pfam profiles PF04408: Helicase associated domain (HA2), PF00271: Helicase conserved C-terminal domain, PF00035: Double-stranded RNA binding motif Length = 1197 Score = 29.1 bits (62), Expect = 3.5 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -3 Query: 112 MTAITRANARRPFILPFDDAFLCEAGGSRVESR 14 MT + + R PF++PFD L E S+ R Sbjct: 810 MTVVAGLSVRDPFLMPFDKKDLAETARSKFSGR 842 >At4g21800.2 68417.m03154 ATP-binding family protein contains Pfam domain, PF03029: Conserved hypothetical ATP binding protein Length = 379 Score = 27.9 bits (59), Expect = 8.0 Identities = 17/83 (20%), Positives = 34/83 (40%) Frame = -2 Query: 596 VILDLNVVVLRTTALIRVVEA*ASLAVYFAIRLPGFVEVCAHHASGVCLVGTVLDAVTHG 417 ++ LN+ + ++ V+E A Y + PG +E+ ASG + Sbjct: 113 ILTSLNLFATKFDEVVSVIEKRADQLDYVLVDTPGQIEIFTWSASGAIITEAFASTFPTV 172 Query: 416 VSVFVDFADTSCAAVDFQARVFH 348 V+ VD S + + F + + + Sbjct: 173 VTYVVD-TPRSSSPITFMSNMLY 194 >At4g21800.1 68417.m03153 ATP-binding family protein contains Pfam domain, PF03029: Conserved hypothetical ATP binding protein Length = 379 Score = 27.9 bits (59), Expect = 8.0 Identities = 17/83 (20%), Positives = 34/83 (40%) Frame = -2 Query: 596 VILDLNVVVLRTTALIRVVEA*ASLAVYFAIRLPGFVEVCAHHASGVCLVGTVLDAVTHG 417 ++ LN+ + ++ V+E A Y + PG +E+ ASG + Sbjct: 113 ILTSLNLFATKFDEVVSVIEKRADQLDYVLVDTPGQIEIFTWSASGAIITEAFASTFPTV 172 Query: 416 VSVFVDFADTSCAAVDFQARVFH 348 V+ VD S + + F + + + Sbjct: 173 VTYVVD-TPRSSSPITFMSNMLY 194 >At2g26350.1 68415.m03163 zinc-binding peroxisomal integral membrane protein (PEX10) identical to zinc-binding peroxisomal integral membrane protein GI:4337011 from [Arabidopsis thaliana] Length = 381 Score = 27.9 bits (59), Expect = 8.0 Identities = 16/45 (35%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = +1 Query: 568 NTTTFKSSITERAEKCLTALKARCLTSPVACGTGFLTSC-ATWLN 699 N +T S+ TE KC L R + CG F SC W N Sbjct: 312 NWSTSDSTSTEAVGKCTLCLSTRQHPTATPCGHVFCWSCIMEWCN 356 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,688,273 Number of Sequences: 28952 Number of extensions: 332787 Number of successful extensions: 993 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 973 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 993 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1755792000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -