BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31138 (784 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglu... 22 4.8 DQ855488-1|ABH88175.1| 112|Tribolium castaneum chemosensory pro... 22 4.8 >EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglucosaminidase NAG1 protein. Length = 598 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/38 (28%), Positives = 18/38 (47%) Frame = +1 Query: 478 KAIIALDAKWHRDCFTCMKCRNPVTDSTFSVMENQPLC 591 K I AL+ W +C + + P+T T + + P C Sbjct: 16 KNISALNGAWRWECKSNYCQKAPITPDTEATGLSLPAC 53 >DQ855488-1|ABH88175.1| 112|Tribolium castaneum chemosensory protein 1 protein. Length = 112 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 300 PCDPSSWRVVARSPLRLR 353 PCDP R+ + +PL LR Sbjct: 57 PCDPVGRRLKSLAPLVLR 74 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,886 Number of Sequences: 336 Number of extensions: 4048 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21168876 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -