BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31138 (784 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g19270.1 68414.m02397 ubiquitin interaction motif-containing ... 51 8e-07 At5g17890.1 68418.m02098 LIM domain-containing protein / disease... 48 5e-06 At4g36860.1 68417.m05226 LIM domain-containing protein low simil... 48 9e-06 At5g66610.1 68418.m08396 LIM domain-containing protein contains ... 47 1e-05 At5g66620.1 68418.m08397 LIM domain-containing protein contains ... 38 0.008 At3g55770.1 68416.m06197 LIM domain-containing protein similar t... 36 0.040 At2g45800.1 68415.m05696 LIM domain-containing protein similar t... 36 0.040 At2g39900.1 68415.m04904 LIM domain-containing protein similar t... 35 0.070 At5g66630.1 68418.m08398 LIM domain-containing protein contains ... 33 0.16 At3g61230.1 68416.m06852 LIM domain-containing protein similar t... 32 0.49 At2g37810.1 68415.m04642 CHP-rich zinc finger protein, putative 32 0.49 At1g53450.2 68414.m06059 expressed protein 30 1.5 At1g53450.1 68414.m06058 expressed protein 30 1.5 At1g10200.1 68414.m01150 transcription factor LIM, putative stro... 30 1.5 At1g01780.1 68414.m00097 LIM domain-containing protein similar t... 30 1.5 At5g60250.1 68418.m07552 zinc finger (C3HC4-type RING finger) fa... 29 2.6 At2g32450.1 68415.m03964 calcium-binding EF hand family protein ... 29 4.6 At2g07630.1 68415.m00881 hypothetical protein 28 6.1 At2g02700.1 68415.m00210 DC1 domain-containing protein contains ... 28 6.1 At5g52950.1 68418.m06570 expressed protein ; expression supporte... 28 8.0 At5g24740.1 68418.m02920 expressed protein 28 8.0 At2g39830.1 68415.m04892 LIM domain-containing protein contains ... 28 8.0 >At1g19270.1 68414.m02397 ubiquitin interaction motif-containing protein / LIM domain-containing protein weak similarity to LIM-homeobox protein [Mus musculus] GI:2149584, Hic-5 [Mus musculus] GI:664955; contains Pfam profiles PF02809: Ubiquitin interaction motif, PF00412: LIM domain Length = 532 Score = 51.2 bits (117), Expect = 8e-07 Identities = 27/86 (31%), Positives = 38/86 (44%), Gaps = 1/86 (1%) Frame = +1 Query: 91 VCNSCDKVI-QGRIVTALNKKWHPEHFVCNTCRKPIDGAKFHQHNNGVHCVPCFTKHHSP 267 +C C+ I GR + LN WHPE F C C +PI +F N C+ + + P Sbjct: 171 ICAGCNMEIGHGRFLNCLNSLWHPECFRCYGCSQPISEYEFSTSGNYPFHKACYRERYHP 230 Query: 268 RCHGCGDPITDRVIQALGVSWHAHHF 345 +C C I A + + AH F Sbjct: 231 KCDVCSHFIPTN--HAGLIEYRAHPF 254 Score = 40.7 bits (91), Expect = 0.001 Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Frame = +1 Query: 448 CKGCGNPIVDKAII-ALDAKWHRDCFTCMKCRNPVTDSTFSVMENQPLCGKC 600 C GC I + L++ WH +CF C C P+++ FS N P C Sbjct: 172 CAGCNMEIGHGRFLNCLNSLWHPECFRCYGCSQPISEYEFSTSGNYPFHKAC 223 Score = 29.5 bits (63), Expect = 2.6 Identities = 15/66 (22%), Positives = 22/66 (33%), Gaps = 1/66 (1%) Frame = +1 Query: 271 CHGCGDPITD-RVIQALGVSWHAHHFVXXXXXXXXXXXXFMEQAGRPYCSDCYADKFATR 447 C GC I R + L WH F F P+ CY +++ + Sbjct: 172 CAGCNMEIGHGRFLNCLNSLWHPECFRCYGCSQPISEYEFSTSGNYPFHKACYRERYHPK 231 Query: 448 CKGCGN 465 C C + Sbjct: 232 CDVCSH 237 >At5g17890.1 68418.m02098 LIM domain-containing protein / disease resistance protein-related low similarity to disease resistance protein RPP4 [Arabidopsis thaliana] GI:20270890; contains Pfam profiles PF00412: LIM domain, PF00931: NB-ARC domain, PF00560: Leucine Rich Repeat Length = 1613 Score = 48.4 bits (110), Expect = 5e-06 Identities = 26/85 (30%), Positives = 38/85 (44%), Gaps = 1/85 (1%) Frame = +1 Query: 94 CNSCDKVIQGRI-VTALNKKWHPEHFVCNTCRKPIDGAKFHQHNNGVHCVPCFTKHHSPR 270 C C I+ I + A WHP+ F C CR+PI + G++ PC+ + P Sbjct: 1240 CKDCKSAIEDGISINAYGSVWHPQCFCCLRCREPIAMNEI-SDLRGMYHKPCYKELRHPN 1298 Query: 271 CHGCGDPITDRVIQALGVSWHAHHF 345 C+ C I A G+ +H H F Sbjct: 1299 CYVCEKKIPR---TAEGLKYHEHPF 1320 Score = 40.3 bits (90), Expect = 0.001 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = +1 Query: 442 TRCKGCGNPIVDK-AIIALDAKWHRDCFTCMKCRNPVTDSTFS 567 ++CK C + I D +I A + WH CF C++CR P+ + S Sbjct: 1238 SKCKDCKSAIEDGISINAYGSVWHPQCFCCLRCREPIAMNEIS 1280 >At4g36860.1 68417.m05226 LIM domain-containing protein low similarity to LIM-domain protein [Branchiostoma floridae] GI:3360516, DRAL/Slim3/FHL2 [Homo sapiens] GI:7209525; contains Pfam profile PF00412: LIM domain Length = 351 Score = 47.6 bits (108), Expect = 9e-06 Identities = 18/44 (40%), Positives = 23/44 (52%) Frame = +1 Query: 151 WHPEHFVCNTCRKPIDGAKFHQHNNGVHCVPCFTKHHSPRCHGC 282 WHPE F CN C KPI +F N + C+ + H P+C C Sbjct: 5 WHPECFCCNACDKPIIDYEFSMSGNRPYHKLCYKEQHHPKCDVC 48 Score = 36.7 bits (81), Expect = 0.017 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +1 Query: 505 WHRDCFTCMKCRNPVTDSTFSVMENQPLCGKC 600 WH +CF C C P+ D FS+ N+P C Sbjct: 5 WHPECFCCNACDKPIIDYEFSMSGNRPYHKLC 36 Score = 28.3 bits (60), Expect = 6.1 Identities = 13/50 (26%), Positives = 17/50 (34%) Frame = +1 Query: 316 LGVSWHAHHFVXXXXXXXXXXXXFMEQAGRPYCSDCYADKFATRCKGCGN 465 +G WH F F RPY CY ++ +C C N Sbjct: 1 MGGVWHPECFCCNACDKPIIDYEFSMSGNRPYHKLCYKEQHHPKCDVCHN 50 >At5g66610.1 68418.m08396 LIM domain-containing protein contains Pfam profile PF00412: LIM domain Length = 529 Score = 47.2 bits (107), Expect = 1e-05 Identities = 24/68 (35%), Positives = 34/68 (50%), Gaps = 3/68 (4%) Frame = +1 Query: 88 AVCNSCDKVIQ-GRIVTALNKKWHPEHFVCNTCRKPIDGAKFHQHN--NGVHCVPCFTKH 258 ++C+ C I+ GR V AL WHPE F C C KPI ++ +H +C P Sbjct: 199 SICDGCKSAIEYGRSVHALGVNWHPECFCCRYCDKPIAMHEYKEHPFWKEKYC-PFHEVD 257 Query: 259 HSPRCHGC 282 +P+C C Sbjct: 258 GTPKCCSC 265 Score = 35.5 bits (78), Expect = 0.040 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = +1 Query: 448 CKGCGNPI-VDKAIIALDAKWHRDCFTCMKCRNPV 549 C GC + I +++ AL WH +CF C C P+ Sbjct: 201 CDGCKSAIEYGRSVHALGVNWHPECFCCRYCDKPI 235 Score = 33.5 bits (73), Expect = 0.16 Identities = 27/99 (27%), Positives = 35/99 (35%), Gaps = 5/99 (5%) Frame = +1 Query: 256 HHSPRCHGCGDPIT-DRVIQALGVSWHAHHFVXXXXXXXXXXXXFMEQA--GRPYCSDCY 426 H C GC I R + ALGV+WH F + E YC Sbjct: 196 HPHSICDGCKSAIEYGRSVHALGVNWHPECFCCRYCDKPIAMHEYKEHPFWKEKYCPFHE 255 Query: 427 ADKFATRCKGCG--NPIVDKAIIALDAKWHRDCFTCMKC 537 D +C C P K ++ D +W C CM+C Sbjct: 256 VDG-TPKCCSCERLEPWGTKYVMLADNRWL--CVKCMEC 291 >At5g66620.1 68418.m08397 LIM domain-containing protein contains Pfam profile PF00412: LIM domain Length = 644 Score = 37.9 bits (84), Expect = 0.008 Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +1 Query: 85 PAVCNSCDKVIQ-GRIVTALNKKWHPEHFVCNTCRKPI 195 P++C C+ ++ G V L WHP F C C KPI Sbjct: 283 PSLCGGCNFAVEHGGSVNILGVLWHPGCFCCRACHKPI 320 Score = 29.1 bits (62), Expect = 3.5 Identities = 11/35 (31%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +1 Query: 448 CKGCGNPIVDKAII-ALDAKWHRDCFTCMKCRNPV 549 C GC + + L WH CF C C P+ Sbjct: 286 CGGCNFAVEHGGSVNILGVLWHPGCFCCRACHKPI 320 >At3g55770.1 68416.m06197 LIM domain-containing protein similar to pollen specific LIM domain protein 1b [Nicotiana tabacum] GI:6467905, PGPS/D1 [Petunia x hybrida] GI:4105772; contains Pfam profile PF00412: LIM domain Length = 199 Score = 35.5 bits (78), Expect = 0.040 Identities = 14/50 (28%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = +1 Query: 445 RCKGCGNPIVDKAIIALDAK-WHRDCFTCMKCRNPVTDSTFSVMENQPLC 591 +CK C + +++ D +H+ CF C C++ + S++S ME C Sbjct: 9 KCKACEKTVYAVELLSADGVGYHKSCFKCTHCKSRLQLSSYSSMEGVLYC 58 Score = 27.9 bits (59), Expect = 8.0 Identities = 11/53 (20%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = +1 Query: 94 CNSCDKVIQG-RIVTALNKKWHPEHFVCNTCRKPIDGAKFHQHNNGVHCVPCF 249 C +C+K + +++A +H F C C+ + + + ++C P F Sbjct: 10 CKACEKTVYAVELLSADGVGYHKSCFKCTHCKSRLQLSSYSSMEGVLYCKPHF 62 Score = 27.9 bits (59), Expect = 8.0 Identities = 10/50 (20%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = +1 Query: 445 RCKGCGNPIVDKAIIALDAK-WHRDCFTCMKCRNPVTDSTFSVMENQPLC 591 +C C + + ++++ +H+ CF C P++ S ++ +E C Sbjct: 107 KCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYC 156 >At2g45800.1 68415.m05696 LIM domain-containing protein similar to PGPS/D1 [Petunia x hybrida] GI:4105772, LIM domain protein PLIM1 [Nicotiana tabacum] GI:5932418; contains Pfam profile PF00412: LIM domain Length = 226 Score = 35.5 bits (78), Expect = 0.040 Identities = 13/50 (26%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = +1 Query: 445 RCKGCGNPIVDKAIIALDAK-WHRDCFTCMKCRNPVTDSTFSVMENQPLC 591 +CK C + ++ L+ +H+ CF C C+ + S +S M+ C Sbjct: 9 KCKACDKTVYVMDLLTLEGNTYHKSCFRCTHCKGTLVISNYSSMDGVLYC 58 >At2g39900.1 68415.m04904 LIM domain-containing protein similar to pollen specific LIM domain protein 1b [Nicotiana tabacum] GI:6467905, PGPS/D1 [Petunia x hybrida] GI:4105772; contains Pfam profile PF00412: LIM domain Length = 200 Score = 34.7 bits (76), Expect = 0.070 Identities = 13/50 (26%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = +1 Query: 445 RCKGCGNPIVDKAIIALDA-KWHRDCFTCMKCRNPVTDSTFSVMENQPLC 591 +C+ C + +++ D +H+ CF C C++ + S +S ME C Sbjct: 9 KCRACEKTVYPVELLSADGISYHKACFKCSHCKSRLQLSNYSSMEGVVYC 58 Score = 28.3 bits (60), Expect = 6.1 Identities = 12/53 (22%), Positives = 25/53 (47%), Gaps = 1/53 (1%) Frame = +1 Query: 94 CNSCDKVIQG-RIVTALNKKWHPEHFVCNTCRKPIDGAKFHQHNNGVHCVPCF 249 C +C+K + +++A +H F C+ C+ + + + V+C P F Sbjct: 10 CRACEKTVYPVELLSADGISYHKACFKCSHCKSRLQLSNYSSMEGVVYCRPHF 62 >At5g66630.1 68418.m08398 LIM domain-containing protein contains low similarity to Pfam profile PF00412: LIM domain Length = 702 Score = 33.5 bits (73), Expect = 0.16 Identities = 14/45 (31%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = +1 Query: 88 AVCNSCDKVIQGR-IVTALNKKWHPEHFVCNTCRKPIDGAKFHQH 219 ++C C+ ++ V L WHP F C +C KPI + H Sbjct: 345 SMCGGCNSAVKHEESVNILGVLWHPGCFCCRSCDKPIAIHELENH 389 Score = 32.7 bits (71), Expect = 0.28 Identities = 11/35 (31%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +1 Query: 448 CKGCGNPIV-DKAIIALDAKWHRDCFTCMKCRNPV 549 C GC + + ++++ L WH CF C C P+ Sbjct: 347 CGGCNSAVKHEESVNILGVLWHPGCFCCRSCDKPI 381 >At3g61230.1 68416.m06852 LIM domain-containing protein similar to SP|P29675 Pollen specific protein SF3 {Helianthus annuus}; contains Pfam profile PF00412: LIM domain Length = 213 Score = 31.9 bits (69), Expect = 0.49 Identities = 12/50 (24%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Frame = +1 Query: 445 RCKGCGNPIVDKAIIALDAK-WHRDCFTCMKCRNPVTDSTFSVMENQPLC 591 +CK C + ++ L+ +H+ CF C C + +S M+ C Sbjct: 10 KCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVICNYSSMDGVLYC 59 Score = 28.3 bits (60), Expect = 6.1 Identities = 10/50 (20%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = +1 Query: 445 RCKGCGNPIVDKAIIALDAK-WHRDCFTCMKCRNPVTDSTFSVMENQPLC 591 +C C + + ++ + +H+ CF C P+T S+++ ++ C Sbjct: 106 KCAACKKTVYPLEKMTMEGESYHKTCFRCAHSGCPLTHSSYAALDGVLYC 155 >At2g37810.1 68415.m04642 CHP-rich zinc finger protein, putative Length = 233 Score = 31.9 bits (69), Expect = 0.49 Identities = 21/69 (30%), Positives = 28/69 (40%), Gaps = 13/69 (18%) Frame = +1 Query: 94 CNSCDKVIQGRIVTA---LNKKWHPEH----FV------CNTCRKPIDGAKFHQHNNGVH 234 C CD V+ T L HP+H FV CN C + ++G +H G Sbjct: 45 CAPCDYVLHDHCATCPFTLISFMHPQHELRLFVNGSENMCNICHRLVEGVYYHCETCGFD 104 Query: 235 CVPCFTKHH 261 P T+HH Sbjct: 105 VHPLCTQHH 113 >At1g53450.2 68414.m06059 expressed protein Length = 453 Score = 30.3 bits (65), Expect = 1.5 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = -3 Query: 257 CLVKQGTQWTPLLCW*NLAPSIGLRQVLQTKCSG 156 C KQGT+ TP++ W + + ++G+ Q L + SG Sbjct: 326 CKSKQGTRITPMINWPDKSLALGVSQALAWRRSG 359 >At1g53450.1 68414.m06058 expressed protein Length = 453 Score = 30.3 bits (65), Expect = 1.5 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = -3 Query: 257 CLVKQGTQWTPLLCW*NLAPSIGLRQVLQTKCSG 156 C KQGT+ TP++ W + + ++G+ Q L + SG Sbjct: 326 CKSKQGTRITPMINWPDKSLALGVSQALAWRRSG 359 >At1g10200.1 68414.m01150 transcription factor LIM, putative strong similarity to transcription factor Ntlim1 [Nicotiana tabacum] GI:5689136, LIM domain protein WLIM-1 [Helianthus annuus] GI:5070280; contains Pfam profile PF00412: LIM domain Length = 190 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/56 (25%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = +1 Query: 94 CNSCDKVIQ-GRIVTALNKKWHPEHFVCNTCRKPIDGAKFHQHNNGVHCVPCFTKH 258 C +CDK + +TA N+ +H F C+ C+ + + ++ ++C P F ++ Sbjct: 10 CMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHFDQN 65 Score = 28.3 bits (60), Expect = 6.1 Identities = 14/51 (27%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = +1 Query: 445 RCKGCGNPI--VDKAIIALDAKWHRDCFTCMKCRNPVTDSTFSVMENQPLC 591 +C C + VDK + A + +H+ CF C C+ + S ++ E C Sbjct: 9 KCMACDKTVYLVDK-LTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYC 58 >At1g01780.1 68414.m00097 LIM domain-containing protein similar to PGPS/D1 [Petunia x hybrida] GI:4105772, LIM domain protein PLIM1 [Nicotiana tabacum] GI:5932418; contains Pfam profile PF00412: LIM domain Length = 205 Score = 30.3 bits (65), Expect = 1.5 Identities = 11/50 (22%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = +1 Query: 445 RCKGCGNPIVDKAIIALDAK-WHRDCFTCMKCRNPVTDSTFSVMENQPLC 591 +C C + +++++ +H+ CF C C+ + S +S M+ C Sbjct: 9 KCNVCDKTVYVVDMLSIEGMPYHKSCFRCTHCKGTLQMSNYSSMDGVLYC 58 >At5g60250.1 68418.m07552 zinc finger (C3HC4-type RING finger) family protein contains a Prosite:PS00518 Zinc finger, C3HC4 type (RING finger), signature and Pfam domain PF01485: IBR domain Length = 655 Score = 29.5 bits (63), Expect = 2.6 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +1 Query: 448 CKGCGNPIVDKAIIALDAKWHRDCFTCMK 534 C C N IV + + ++D HR CF C+K Sbjct: 301 CAICFNDIVAEGMFSVDKCRHRFCFQCVK 329 >At2g32450.1 68415.m03964 calcium-binding EF hand family protein low similarity to O-linked GlcNAc transferase [Homo sapiens] GI:2266994; contains Pfam profiles PF00036: EF hand, PF00515: TPR Domain Length = 802 Score = 28.7 bits (61), Expect = 4.6 Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = +1 Query: 169 VCNTCRKPIDGAKFHQHNNGVH-CVPCFTKHHSP 267 VC+ CR PI G++F + G C C+++ P Sbjct: 730 VCSVCRYPIIGSRFKEVKTGFSLCNQCYSEGKIP 763 >At2g07630.1 68415.m00881 hypothetical protein Length = 458 Score = 28.3 bits (60), Expect = 6.1 Identities = 14/46 (30%), Positives = 19/46 (41%) Frame = +1 Query: 484 IIALDAKWHRDCFTCMKCRNPVTDSTFSVMENQPLCGKCA*FITNI 621 I +D W C KC VT + ++ Q C C ITN+ Sbjct: 260 IYDIDRDWSWYYIVCKKCNKKVTKVVMTSLKAQLWCETCRAPITNV 305 >At2g02700.1 68415.m00210 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 499 Score = 28.3 bits (60), Expect = 6.1 Identities = 17/55 (30%), Positives = 23/55 (41%) Frame = +1 Query: 91 VCNSCDKVIQGRIVTALNKKWHPEHFVCNTCRKPIDGAKFHQHNNGVHCVPCFTK 255 VC CD ++ + A KK HP H PI+ H+ N+ C C K Sbjct: 393 VCVKCDFILHEKCADAPRKKVHPLH------PHPIEQKVVHE-NHEFECAACMRK 440 >At5g52950.1 68418.m06570 expressed protein ; expression supported by MPSS Length = 945 Score = 27.9 bits (59), Expect = 8.0 Identities = 14/53 (26%), Positives = 23/53 (43%) Frame = -2 Query: 525 REAIAVPLSIKRDDGFIDDWISAPLAASGELVCVAVGAIGTASLFHEPSTAKL 367 RE + +S +G + I P S L+CV + ++ HE S K+ Sbjct: 424 REGFSALVSFSNSNGSLRTGILKPFTFSSALICVFDNGVSPQTVDHEDSRKKV 476 >At5g24740.1 68418.m02920 expressed protein Length = 3306 Score = 27.9 bits (59), Expect = 8.0 Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = -3 Query: 248 KQGTQWTPL-LCW*NLAPSIGLRQVLQTKCSG 156 KQG P+ L W N+ IGL V+ T CSG Sbjct: 3193 KQGFLGVPIDLVW-NIEREIGLESVIHTDCSG 3223 >At2g39830.1 68415.m04892 LIM domain-containing protein contains Pfam profile PF00412: LIM domain Length = 503 Score = 27.9 bits (59), Expect = 8.0 Identities = 15/63 (23%), Positives = 29/63 (46%), Gaps = 4/63 (6%) Frame = +1 Query: 91 VCNSCDKVI-QGRIVTALNKKWHPEHFVCNTCRKPIDGAKFHQHNNGV---HCVPCFTKH 258 +C C+ I G + + +HPE F C++C I + ++ G+ C P + + Sbjct: 161 ICGGCNSDIGSGNYLGCMGTFFHPECFRCHSCGYAITEHEIPTNDAGLIEYRCHPFWNQK 220 Query: 259 HSP 267 + P Sbjct: 221 YCP 223 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,778,243 Number of Sequences: 28952 Number of extensions: 355566 Number of successful extensions: 1112 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 1038 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1109 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1755792000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -