BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31135 (672 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1494.05c |ubp12||ubiquitin C-terminal hydrolase Ubp12|Schizo... 29 0.81 SPAP27G11.16 |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 28 1.4 SPAC4A8.08c |vas1||mitochondrial valine-tRNA ligase Vas1|Schizos... 27 3.3 SPCC1393.07c |mug4||sequence orphan|Schizosaccharomyces pombe|ch... 26 4.3 SPAC1D4.06c |csk1||cyclin-dependent kinase activating kinase Csk... 26 5.7 SPBC30D10.17c |||glucan synthase regulator |Schizosaccharomyces ... 25 7.5 SPBC609.05 |pob3||FACT complex component Pob3|Schizosaccharomyce... 25 7.5 SPAC589.02c |med13|spTrap240, srb9|mediator complex subunit Srb9... 25 9.9 SPAC1071.03c |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 25 9.9 >SPCC1494.05c |ubp12||ubiquitin C-terminal hydrolase Ubp12|Schizosaccharomyces pombe|chr 3|||Manual Length = 979 Score = 28.7 bits (61), Expect = 0.81 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 3/38 (7%) Frame = +1 Query: 310 CLINFRW*F---LRLPWLSRVTGNQGSIPEREPEKRLP 414 C+IN W LRL +L + NQ S E++ EKR+P Sbjct: 271 CMINETWPVDRALRLQFLIQQRNNQSSNEEQKQEKRVP 308 >SPAP27G11.16 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 104 Score = 27.9 bits (59), Expect = 1.4 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 654 AAHKCNYELFNRNNFSIRYWSWNYRGLLAPEL 559 AA KC +E FSI + S+N++ +P L Sbjct: 73 AASKCEFEKIWSTTFSISFLSFNFKSSESPSL 104 >SPAC4A8.08c |vas1||mitochondrial valine-tRNA ligase Vas1|Schizosaccharomyces pombe|chr 1|||Manual Length = 950 Score = 26.6 bits (56), Expect = 3.3 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = +1 Query: 343 LPWLSRVTGNQGSIPEREPEKRLPHPRKAAGAQITHSRHGEVVTKN 480 +P +S V + IPER+ + L P + H EVV +N Sbjct: 757 VPCISGVMLHSKIIPERKNSEFLSFPTSQQECLLVHDNQAEVVVQN 802 >SPCC1393.07c |mug4||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 845 Score = 26.2 bits (55), Expect = 4.3 Identities = 16/34 (47%), Positives = 22/34 (64%) Frame = -2 Query: 521 LIPITRPRKSPVSLFFVTTSPCREWVICAPAAFL 420 +IPI + KS +SL F+T SPC + IC+ A L Sbjct: 45 IIPIAQ--KSNISLPFLTLSPC-SFTICSLRARL 75 >SPAC1D4.06c |csk1||cyclin-dependent kinase activating kinase Csk1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 306 Score = 25.8 bits (54), Expect = 5.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -1 Query: 423 PWMW*PFLRLPLRNRTLIPRYP*QPW*SQKLPS 325 P MW P N+ + YP +PW S+ LPS Sbjct: 236 PSMWPELSTFPDWNKFIFHEYPPKPW-SEILPS 267 >SPBC30D10.17c |||glucan synthase regulator |Schizosaccharomyces pombe|chr 2|||Manual Length = 504 Score = 25.4 bits (53), Expect = 7.5 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -3 Query: 421 LDVVAVSQAPSPESNPDSPLPVTTMVVAETTIES 320 L ++ S+ P + PD P T+ V+ TT+E+ Sbjct: 422 LGLINTSEINQPANLPDEPTAETSNPVSATTVEA 455 >SPBC609.05 |pob3||FACT complex component Pob3|Schizosaccharomyces pombe|chr 2|||Manual Length = 512 Score = 25.4 bits (53), Expect = 7.5 Identities = 11/36 (30%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = -1 Query: 645 KCNYEL-FNRNNFSIRYWSWNYRGLLAPELASNCSS 541 K N+++ + FSI+ W+W L EL + +S Sbjct: 89 KQNFDMGIEQKEFSIKGWNWGEANFLGSELVFDVNS 124 >SPAC589.02c |med13|spTrap240, srb9|mediator complex subunit Srb9|Schizosaccharomyces pombe|chr 1|||Manual Length = 1223 Score = 25.0 bits (52), Expect = 9.9 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +1 Query: 532 IF*RGTIGGKFWCQQPAV 585 IF + GGK+WC P++ Sbjct: 528 IFQKYNYGGKYWCPSPSL 545 >SPAC1071.03c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 338 Score = 25.0 bits (52), Expect = 9.9 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = +2 Query: 74 NGSIYQFWFLRSYSVTWITVVILELIHAIRTLTSD 178 N IY+ +F ++S++ + + I L +RT++SD Sbjct: 14 NTQIYRIFFTLTFSLSNLFLAICYLFLNVRTVSSD 48 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,799,116 Number of Sequences: 5004 Number of extensions: 59325 Number of successful extensions: 130 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 121 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 130 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 307866294 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -