BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31135 (672 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50608| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_59794| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_492| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_51316| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_18079| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_56793| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_1371| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.052 SB_25694| Best HMM Match : RVT_1 (HMM E-Value=1.9e-22) 32 0.48 SB_15796| Best HMM Match : RVT_1 (HMM E-Value=0.00082) 32 0.48 SB_12062| Best HMM Match : NUC129 (HMM E-Value=9.2) 31 0.84 SB_54231| Best HMM Match : Ammonium_transp (HMM E-Value=0) 29 4.5 SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) 28 7.9 >SB_50608| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 40 Score = 47.6 bits (108), Expect = 9e-06 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +1 Query: 577 PAVIPAPIAYTKIVAVKKLVVAFVRRAVGAP 669 PAVIPAPIAY K+VAVKKLVV F VG P Sbjct: 8 PAVIPAPIAYIKVVAVKKLVVGFRDGTVGPP 38 >SB_59794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -3 Query: 418 DVVAVSQAPSPESNPDSPLPVTTM 347 DVVAVSQAPSPESNP+SP PV TM Sbjct: 105 DVVAVSQAPSPESNPNSPSPVVTM 128 >SB_492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 44.8 bits (101), Expect = 6e-05 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +1 Query: 580 AVIPAPIAYTKIVAVKKLVVAFVRRAVGAP 669 AVIPAPIAY K+VAVKKLVV F VG P Sbjct: 36 AVIPAPIAYIKVVAVKKLVVGFRDGTVGPP 65 >SB_51316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 44.8 bits (101), Expect = 6e-05 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +1 Query: 580 AVIPAPIAYTKIVAVKKLVVAFVRRAVGAP 669 AVIPAPIAY K+VAVKKLVV F VG P Sbjct: 81 AVIPAPIAYIKVVAVKKLVVGFRDGTVGPP 110 >SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 44.8 bits (101), Expect = 6e-05 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +1 Query: 580 AVIPAPIAYTKIVAVKKLVVAFVRRAVGAP 669 AVIPAPIAY K+VAVKKLVV F VG P Sbjct: 73 AVIPAPIAYIKVVAVKKLVVGFRDGTVGPP 102 >SB_18079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 44.8 bits (101), Expect = 6e-05 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +1 Query: 580 AVIPAPIAYTKIVAVKKLVVAFVRRAVGAP 669 AVIPAPIAY K+VAVKKLVV F VG P Sbjct: 26 AVIPAPIAYIKVVAVKKLVVGFRDGTVGPP 55 >SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 44.8 bits (101), Expect = 6e-05 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +1 Query: 580 AVIPAPIAYTKIVAVKKLVVAFVRRAVGAP 669 AVIPAPIAY K+VAVKKLVV F VG P Sbjct: 13 AVIPAPIAYIKVVAVKKLVVGFRDGTVGPP 42 >SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 41.1 bits (92), Expect = 8e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 409 AVSQAPSPESNPDSPLPVTTM 347 AVSQAPSPESNP+SP PV TM Sbjct: 52 AVSQAPSPESNPNSPSPVVTM 72 >SB_56793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/26 (73%), Positives = 19/26 (73%) Frame = +3 Query: 3 VVICLSQRLSHACLSASRIKAIPRMA 80 VVICLSQRLSHACLS S RMA Sbjct: 136 VVICLSQRLSHACLSISTCTVKLRMA 161 >SB_1371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.1 bits (82), Expect = 0.013 Identities = 19/26 (73%), Positives = 19/26 (73%) Frame = +3 Query: 3 VVICLSQRLSHACLSASRIKAIPRMA 80 VVICLSQRLSHACLS S RMA Sbjct: 112 VVICLSQRLSHACLSISTRTVKLRMA 137 >SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 35.1 bits (77), Expect = 0.052 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -1 Query: 408 PFLRLPLRNRTLIPRYP 358 PFLRLPLRNRTLI R+P Sbjct: 224 PFLRLPLRNRTLILRHP 240 >SB_25694| Best HMM Match : RVT_1 (HMM E-Value=1.9e-22) Length = 1797 Score = 31.9 bits (69), Expect = 0.48 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = +1 Query: 7 LYACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYLDNCGNS 141 L CL D A+ ++ + +Y W+N+ +LV L ++ CG+S Sbjct: 447 LMTCLYDKAVFLTDEEYAAKYGRWVNVQMLVEEPELHFIAKCGSS 491 >SB_15796| Best HMM Match : RVT_1 (HMM E-Value=0.00082) Length = 1304 Score = 31.9 bits (69), Expect = 0.48 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = +1 Query: 7 LYACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYLDNCGNS 141 L CL D A+ ++ + +Y W+N+ +LV L ++ CG+S Sbjct: 866 LMTCLYDKAVFLTDEEYAAKYGRWVNVQMLVEEPELHFIAKCGSS 910 >SB_12062| Best HMM Match : NUC129 (HMM E-Value=9.2) Length = 111 Score = 31.1 bits (67), Expect = 0.84 Identities = 15/23 (65%), Positives = 16/23 (69%) Frame = +1 Query: 601 AYTKIVAVKKLVVAFVRRAVGAP 669 AY K+VAVKKLVV F VG P Sbjct: 87 AYIKVVAVKKLVVGFRDGTVGPP 109 >SB_54231| Best HMM Match : Ammonium_transp (HMM E-Value=0) Length = 459 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/37 (35%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = -1 Query: 630 LFNRNNFSIRYWSWNYRGLLA-PELASNCSSLKYLKC 523 L+ N +S W+WN GLLA ++ C++L + C Sbjct: 335 LYRWNKYSFYAWAWNIVGLLAIMAWSAGCAALMFGFC 371 >SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) Length = 441 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -3 Query: 427 PSLDVVAVSQAPSPESNPDSPLP 359 P+ DV+A Q P P S D PLP Sbjct: 75 PAEDVMAAHQEPKPTSAIDQPLP 97 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,578,399 Number of Sequences: 59808 Number of extensions: 467305 Number of successful extensions: 1228 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 1099 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1228 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1721264831 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -