BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31133 (782 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC16C4.18c |taf50||histone H4-like TAF |Schizosaccharomyces po... 27 3.0 >SPCC16C4.18c |taf50||histone H4-like TAF |Schizosaccharomyces pombe|chr 3|||Manual Length = 452 Score = 27.1 bits (57), Expect = 3.0 Identities = 11/30 (36%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = +1 Query: 382 DMPILIGVGGTC-EPVTVDALDMSLRIHQI 468 D+ ++G+G EP A+D+ RIHQ+ Sbjct: 13 DVAEMLGIGNLADEPAAAIAMDLEYRIHQV 42 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,862,757 Number of Sequences: 5004 Number of extensions: 50775 Number of successful extensions: 100 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 97 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 100 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 379359666 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -