BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31133 (782 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein p... 24 1.4 DQ435335-1|ABD92650.1| 135|Apis mellifera OBP18 protein. 22 5.6 >DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein protein. Length = 430 Score = 24.2 bits (50), Expect = 1.4 Identities = 12/32 (37%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +1 Query: 328 PAFALIALLYRTKSYRFSDMPILIGVGGT-CE 420 P F L L Y +R MP+ + GT CE Sbjct: 383 PVFLLXTLNYTDVXFRILTMPVRDAIAGTICE 414 >DQ435335-1|ABD92650.1| 135|Apis mellifera OBP18 protein. Length = 135 Score = 22.2 bits (45), Expect = 5.6 Identities = 11/44 (25%), Positives = 24/44 (54%) Frame = -3 Query: 774 LMLR*LSQFYQDRCATTELSLSDSCTSVSQ*DLATQGQLLRECI 643 +++R +++ + D +L C+++S DLA + L +CI Sbjct: 82 VVIREIAEIFLDENGVNKLITE--CSAISDADLAVKSAKLLKCI 123 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 199,004 Number of Sequences: 438 Number of extensions: 3749 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24639531 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -