BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31132 (829 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PL... 31 0.93 At5g06970.1 68418.m00789 expressed protein 29 2.8 At1g22900.1 68414.m02860 disease resistance-responsive family pr... 28 6.6 >At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PLDBETA1) identical to SP|P93733 Phospholipase D beta 1 (EC 3.1.4.4) (AtPLDbeta1) (PLD beta 1) (PLDbeta) {Arabidopsis thaliana}; contains Pfam profiles: PF00614 phospholipase D.active site motif, PF00168 C2 domain Length = 1083 Score = 31.1 bits (67), Expect = 0.93 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = +1 Query: 340 SEEMLYCFFLEATLSYLLVYANFQEYIYHLKRLVSYQSHHKYL 468 S +M F + +L LL++ N +IYH K L + HK L Sbjct: 253 SADMQMTLFGKGSLKVLLLHGNLDIWIYHAKNLPNMDMFHKTL 295 >At5g06970.1 68418.m00789 expressed protein Length = 1101 Score = 29.5 bits (63), Expect = 2.8 Identities = 17/46 (36%), Positives = 26/46 (56%) Frame = -1 Query: 427 SDKYILENLHKLTNKKELLPKKNNTAFLQILSQRAPKI*LFNTKHI 290 SD+ +L L + + L KK++T F+ ILSQR P+ F+ I Sbjct: 595 SDRNNEHHLALLAEETKKLMKKDSTIFMPILSQRHPQAIAFSASLI 640 >At1g22900.1 68414.m02860 disease resistance-responsive family protein similar to pathogenesis-related protein [Pisum sativum] gi|4585273|gb|AAD25355 Length = 187 Score = 28.3 bits (60), Expect = 6.6 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = -2 Query: 192 IFNSLLLVIFSLFQEKPD*KTISCKNKEVHKLLYIHNY 79 IF+++LL+ ++ Q KP KT + + KL ++H Y Sbjct: 13 IFSTVLLLTITVTQSKPYSKTTPFQGNKPDKLTHLHFY 50 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,323,018 Number of Sequences: 28952 Number of extensions: 280389 Number of successful extensions: 552 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 539 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 552 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1902108000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -