Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= epV31127
         (454 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q9LJ76 Cluster: En/Spm transposon protein-like; n=1; Ar...    35   0.71 
UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bomb...    32   5.0  

>UniRef50_Q9LJ76 Cluster: En/Spm transposon protein-like; n=1;
           Arabidopsis thaliana|Rep: En/Spm transposon protein-like
           - Arabidopsis thaliana (Mouse-ear cress)
          Length = 818

 Score = 35.1 bits (77), Expect = 0.71
 Identities = 20/58 (34%), Positives = 29/58 (50%)
 Frame = -1

Query: 280 TSYHVNAPATLRYKF*DLSLVTTAALPFRPKRITASRQK*AGPWYLPVRTHTRSYHNL 107
           T   VN PA+  +      L  T  LP + K++  SR+  + PWY+ +R   R YH L
Sbjct: 336 TESRVNPPASSIF-LQTAFLRDTYILPSQAKQVFYSREDESSPWYVVMRAPPRGYHEL 392


>UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bombyx
           mori (Silk moth)
          Length = 782

 Score = 32.3 bits (70), Expect = 5.0
 Identities = 11/13 (84%), Positives = 11/13 (84%)
 Frame = -1

Query: 151 WYLPVRTHTRSYH 113
           WYLP RTH RSYH
Sbjct: 572 WYLPARTHKRSYH 584


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 397,043,406
Number of Sequences: 1657284
Number of extensions: 7005683
Number of successful extensions: 10787
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 10624
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10787
length of database: 575,637,011
effective HSP length: 94
effective length of database: 419,852,315
effective search space used: 23511729640
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)