BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31127 (454 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_04_0386 + 20822376-20822982,20823715-20824244,20824315-20825127 27 5.3 12_02_0872 + 23884715-23885770 27 9.3 >05_04_0386 + 20822376-20822982,20823715-20824244,20824315-20825127 Length = 649 Score = 27.5 bits (58), Expect = 5.3 Identities = 12/47 (25%), Positives = 24/47 (51%) Frame = +3 Query: 156 PAYFCREAVMRFGLKGRAAVVTKLRS*NLYLKVAGAFTWXDVYGLLT 296 P + R +FGL+G A + R L ++ + W +++G+L+ Sbjct: 574 PLRYARLIYSQFGLEGLFAALLGHRPVRLLKQLRSIYPWQNIFGILS 620 >12_02_0872 + 23884715-23885770 Length = 351 Score = 26.6 bits (56), Expect = 9.3 Identities = 16/43 (37%), Positives = 19/43 (44%) Frame = +3 Query: 132 VRTGRYHGPAYFCREAVMRFGLKGRAAVVTKLRS*NLYLKVAG 260 +R G +HG A V R G RAAV + Y VAG Sbjct: 1 MRRGGFHGAAAASPTTVARAGRVMRAAVAAFFHGYHCYTSVAG 43 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,453,978 Number of Sequences: 37544 Number of extensions: 188616 Number of successful extensions: 257 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 253 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 257 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 883560296 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -