BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31127 (454 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 24 2.2 AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol ... 22 8.8 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 24.2 bits (50), Expect = 2.2 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -3 Query: 185 HYCFTAEIGRAVVPTRADSHEVLP 114 H F AEIG ++V DS E+LP Sbjct: 939 HIEFHAEIGMSLVLKVGDSSEMLP 962 >AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol kinase protein. Length = 555 Score = 22.2 bits (45), Expect = 8.8 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = -3 Query: 239 ILRSQFSYNGCPTLQTETHYCFTAEIGRAVVPTRAD 132 +++ Q +G P L+TE H A +G A+ +A+ Sbjct: 433 LMQLQADLSGIPVLRTEVHE--PAALGTAMAAAQAN 466 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 424,153 Number of Sequences: 2352 Number of extensions: 7910 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 38694201 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -