BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31127 (454 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF531618-1|ABQ43327.1| 1094|Homo sapiens solute carrier family 4... 29 5.6 AF310248-1|AAG47773.1| 1079|Homo sapiens sodium bicarbonate cotr... 29 5.6 AF157492-1|AAF80343.1| 995|Homo sapiens sodium bicarbonate cotr... 29 5.6 AF069510-1|AAD42020.1| 1079|Homo sapiens sodium bicarbonate cotr... 29 5.6 AF053754-1|AAF21719.1| 1079|Homo sapiens electrogenic Na+ bicarb... 29 5.6 AF011390-1|AAC39840.1| 1079|Homo sapiens pancreas sodium bicarbo... 29 5.6 AF007216-1|AAC51645.1| 1035|Homo sapiens sodium bicarbonate cotr... 29 5.6 AF053753-1|AAF21718.1| 1079|Homo sapiens electrogenic Na+ bicarb... 29 9.8 >EF531618-1|ABQ43327.1| 1094|Homo sapiens solute carrier family 4 sodium bicarbonate cotransporter member 4 variant C protein. Length = 1094 Score = 29.5 bits (63), Expect = 5.6 Identities = 16/52 (30%), Positives = 22/52 (42%) Frame = -1 Query: 259 PATLRYKF*DLSLVTTAALPFRPKRITASRQK*AGPWYLPVRTHTRSYHNLT 104 P +K +L + +P P I+ S P YLP + T YHN T Sbjct: 612 PINSNFKVGYNTLFSCTCVPPDPANISISNDTTLAPEYLPTMSSTDMYHNTT 663 >AF310248-1|AAG47773.1| 1079|Homo sapiens sodium bicarbonate cotransporter protein. Length = 1079 Score = 29.5 bits (63), Expect = 5.6 Identities = 16/52 (30%), Positives = 22/52 (42%) Frame = -1 Query: 259 PATLRYKF*DLSLVTTAALPFRPKRITASRQK*AGPWYLPVRTHTRSYHNLT 104 P +K +L + +P P I+ S P YLP + T YHN T Sbjct: 612 PINSNFKVGYNTLFSCTCVPPDPANISISNDTTLAPEYLPTMSSTDMYHNTT 663 >AF157492-1|AAF80343.1| 995|Homo sapiens sodium bicarbonate cotransporter NBC1 protein. Length = 995 Score = 29.5 bits (63), Expect = 5.6 Identities = 16/52 (30%), Positives = 22/52 (42%) Frame = -1 Query: 259 PATLRYKF*DLSLVTTAALPFRPKRITASRQK*AGPWYLPVRTHTRSYHNLT 104 P +K +L + +P P I+ S P YLP + T YHN T Sbjct: 612 PINSNFKVGYNTLFSCTCVPPDPANISISNDTTLAPEYLPTMSSTDMYHNTT 663 >AF069510-1|AAD42020.1| 1079|Homo sapiens sodium bicarbonate cotransporter protein. Length = 1079 Score = 29.5 bits (63), Expect = 5.6 Identities = 16/52 (30%), Positives = 22/52 (42%) Frame = -1 Query: 259 PATLRYKF*DLSLVTTAALPFRPKRITASRQK*AGPWYLPVRTHTRSYHNLT 104 P +K +L + +P P I+ S P YLP + T YHN T Sbjct: 612 PINSNFKVGYNTLFSCTCVPPDPANISISNDTTLAPEYLPTMSSTDMYHNTT 663 >AF053754-1|AAF21719.1| 1079|Homo sapiens electrogenic Na+ bicarbonate cotransporter form 2 protein. Length = 1079 Score = 29.5 bits (63), Expect = 5.6 Identities = 16/52 (30%), Positives = 22/52 (42%) Frame = -1 Query: 259 PATLRYKF*DLSLVTTAALPFRPKRITASRQK*AGPWYLPVRTHTRSYHNLT 104 P +K +L + +P P I+ S P YLP + T YHN T Sbjct: 612 PINSNFKVGYNTLFSCTCVPPDPANISISNDTTLAPEYLPTMSSTDMYHNTT 663 >AF011390-1|AAC39840.1| 1079|Homo sapiens pancreas sodium bicarbonate cotransporter protein. Length = 1079 Score = 29.5 bits (63), Expect = 5.6 Identities = 16/52 (30%), Positives = 22/52 (42%) Frame = -1 Query: 259 PATLRYKF*DLSLVTTAALPFRPKRITASRQK*AGPWYLPVRTHTRSYHNLT 104 P +K +L + +P P I+ S P YLP + T YHN T Sbjct: 612 PINSNFKVGYNTLFSCTCVPPDPANISISNDTTLAPEYLPTMSSTDMYHNTT 663 >AF007216-1|AAC51645.1| 1035|Homo sapiens sodium bicarbonate cotransporter protein. Length = 1035 Score = 29.5 bits (63), Expect = 5.6 Identities = 16/52 (30%), Positives = 22/52 (42%) Frame = -1 Query: 259 PATLRYKF*DLSLVTTAALPFRPKRITASRQK*AGPWYLPVRTHTRSYHNLT 104 P +K +L + +P P I+ S P YLP + T YHN T Sbjct: 568 PINSNFKVGYNTLFSCTCVPPDPANISISNDTTLAPEYLPTMSSTDMYHNTT 619 >AF053753-1|AAF21718.1| 1079|Homo sapiens electrogenic Na+ bicarbonate cotransporter protein. Length = 1079 Score = 28.7 bits (61), Expect = 9.8 Identities = 16/52 (30%), Positives = 21/52 (40%) Frame = -1 Query: 259 PATLRYKF*DLSLVTTAALPFRPKRITASRQK*AGPWYLPVRTHTRSYHNLT 104 P +K +L + +P P I+ S P YLP T YHN T Sbjct: 612 PINSNFKVGYNTLFSCTCVPPDPANISISNDTTLAPEYLPTMPSTDMYHNTT 663 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 57,620,379 Number of Sequences: 237096 Number of extensions: 1061222 Number of successful extensions: 1294 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1250 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1294 length of database: 76,859,062 effective HSP length: 84 effective length of database: 56,942,998 effective search space used: 3758237868 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -