BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31125 (472 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U95299-1|AAC32288.1| 2003|Homo sapiens Notch4 protein. 29 8.1 U89335-1|AAC63097.1| 1999|Homo sapiens notch4 protein. 29 8.1 D86566-1|BAA13116.1| 955|Homo sapiens notch related protein pro... 29 8.1 D63395-1|BAA09708.1| 1095|Homo sapiens notch related protein pro... 29 8.1 BX284927-1|CAM25850.1| 2003|Homo sapiens Notch homolog 4 (Drosop... 29 8.1 BX284686-1|CAM26209.1| 2003|Homo sapiens Notch homolog 4 (Drosop... 29 8.1 BC065936-1|AAH65936.2| 418|Homo sapiens ST3 beta-galactoside al... 29 8.1 AL845509-1|CAI18564.1| 2003|Homo sapiens Notch homolog 4 (Drosop... 29 8.1 AL845464-12|CAI41803.1| 2003|Homo sapiens Notch homolog 4 (Droso... 29 8.1 AL662884-27|CAI18362.1| 2003|Homo sapiens Notch homolog 4 (Droso... 29 8.1 AL662830-9|CAI17543.1| 2005|Homo sapiens Notch homolog 4 (Drosop... 29 8.1 >U95299-1|AAC32288.1| 2003|Homo sapiens Notch4 protein. Length = 2003 Score = 29.1 bits (62), Expect = 8.1 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +3 Query: 36 CSPGFRVSQASAGELHV-PCSCCIYRSGRCCVHRPPGVLC 152 C PGF Q S + HV PC ++G C+ +P G LC Sbjct: 918 CPPGF---QGSLCQDHVNPCESRPCQNGATCMAQPSGYLC 954 >U89335-1|AAC63097.1| 1999|Homo sapiens notch4 protein. Length = 1999 Score = 29.1 bits (62), Expect = 8.1 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +3 Query: 36 CSPGFRVSQASAGELHV-PCSCCIYRSGRCCVHRPPGVLC 152 C PGF Q S + HV PC ++G C+ +P G LC Sbjct: 917 CPPGF---QGSLCQDHVNPCESRPCQNGATCMAQPSGYLC 953 >D86566-1|BAA13116.1| 955|Homo sapiens notch related protein protein. Length = 955 Score = 29.1 bits (62), Expect = 8.1 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +3 Query: 36 CSPGFRVSQASAGELHV-PCSCCIYRSGRCCVHRPPGVLC 152 C PGF Q S + HV PC ++G C+ +P G LC Sbjct: 918 CPPGF---QGSLCQDHVNPCESRPCQNGATCMAQPSGYLC 954 >D63395-1|BAA09708.1| 1095|Homo sapiens notch related protein protein. Length = 1095 Score = 29.1 bits (62), Expect = 8.1 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +3 Query: 36 CSPGFRVSQASAGELHV-PCSCCIYRSGRCCVHRPPGVLC 152 C PGF Q S + HV PC ++G C+ +P G LC Sbjct: 10 CPPGF---QGSLCQDHVNPCESRPCQNGATCMAQPSGYLC 46 >BX284927-1|CAM25850.1| 2003|Homo sapiens Notch homolog 4 (Drosophila) protein. Length = 2003 Score = 29.1 bits (62), Expect = 8.1 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +3 Query: 36 CSPGFRVSQASAGELHV-PCSCCIYRSGRCCVHRPPGVLC 152 C PGF Q S + HV PC ++G C+ +P G LC Sbjct: 918 CPPGF---QGSLCQDHVNPCESRPCQNGATCMAQPSGYLC 954 >BX284686-1|CAM26209.1| 2003|Homo sapiens Notch homolog 4 (Drosophila) protein. Length = 2003 Score = 29.1 bits (62), Expect = 8.1 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +3 Query: 36 CSPGFRVSQASAGELHV-PCSCCIYRSGRCCVHRPPGVLC 152 C PGF Q S + HV PC ++G C+ +P G LC Sbjct: 918 CPPGF---QGSLCQDHVNPCESRPCQNGATCMAQPSGYLC 954 >BC065936-1|AAH65936.2| 418|Homo sapiens ST3 beta-galactoside alpha-2,3-sialyltransferase 5 protein. Length = 418 Score = 29.1 bits (62), Expect = 8.1 Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 1/56 (1%) Frame = -1 Query: 184 RSMQPENMQSMQSTPGGRCTQQRPERYMQ-QLQGTCSSPAEAWLTRKPGEQRRSSI 20 R +QP + + P GR P Y +L+ CS P+ W TR + RR S+ Sbjct: 12 RPLQPRTEAA--AAPAGRAM---PSEYTYVKLRSDCSRPSLQWYTRAQSKMRRPSL 62 >AL845509-1|CAI18564.1| 2003|Homo sapiens Notch homolog 4 (Drosophila) protein. Length = 2003 Score = 29.1 bits (62), Expect = 8.1 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +3 Query: 36 CSPGFRVSQASAGELHV-PCSCCIYRSGRCCVHRPPGVLC 152 C PGF Q S + HV PC ++G C+ +P G LC Sbjct: 918 CPPGF---QGSLCQDHVNPCESRPCQNGATCMAQPSGYLC 954 >AL845464-12|CAI41803.1| 2003|Homo sapiens Notch homolog 4 (Drosophila) protein. Length = 2003 Score = 29.1 bits (62), Expect = 8.1 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +3 Query: 36 CSPGFRVSQASAGELHV-PCSCCIYRSGRCCVHRPPGVLC 152 C PGF Q S + HV PC ++G C+ +P G LC Sbjct: 918 CPPGF---QGSLCQDHVNPCESRPCQNGATCMAQPSGYLC 954 >AL662884-27|CAI18362.1| 2003|Homo sapiens Notch homolog 4 (Drosophila) protein. Length = 2003 Score = 29.1 bits (62), Expect = 8.1 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +3 Query: 36 CSPGFRVSQASAGELHV-PCSCCIYRSGRCCVHRPPGVLC 152 C PGF Q S + HV PC ++G C+ +P G LC Sbjct: 918 CPPGF---QGSLCQDHVNPCESRPCQNGATCMAQPSGYLC 954 >AL662830-9|CAI17543.1| 2005|Homo sapiens Notch homolog 4 (Drosophila) protein. Length = 2005 Score = 29.1 bits (62), Expect = 8.1 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +3 Query: 36 CSPGFRVSQASAGELHV-PCSCCIYRSGRCCVHRPPGVLC 152 C PGF Q S + HV PC ++G C+ +P G LC Sbjct: 920 CPPGF---QGSLCQDHVNPCESRPCQNGATCMAQPSGYLC 956 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 49,043,815 Number of Sequences: 237096 Number of extensions: 711178 Number of successful extensions: 2146 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 2063 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2146 length of database: 76,859,062 effective HSP length: 84 effective length of database: 56,942,998 effective search space used: 4099895856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -