BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31122 (631 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 31 0.011 AF265297-1|AAG17640.1| 125|Tribolium castaneum putative cytochr... 23 1.6 AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. 21 6.4 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 8.5 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 30.7 bits (66), Expect = 0.011 Identities = 19/45 (42%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +1 Query: 184 KEFVRPVHDAHVHDEFERFKVKHQRQY-ASDLEHEKRLNIFRQSL 315 K F + +A V E R ++ R Y ASDLE E RL FR+ L Sbjct: 157 KVFAKAREEATVVPEGSRTPIEIPRDYTASDLEEEHRLAYFREDL 201 >AF265297-1|AAG17640.1| 125|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 125 Score = 23.4 bits (48), Expect = 1.6 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -3 Query: 368 FTDMVKPRFARLFECMYLSDCLK 300 F+D KP + L E Y+ C+K Sbjct: 30 FSDDTKPDYKSLQELKYMERCIK 52 >AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. Length = 301 Score = 21.4 bits (43), Expect = 6.4 Identities = 11/34 (32%), Positives = 14/34 (41%) Frame = +1 Query: 118 SNMQCTGFPGPGSRHFATFNPMKEFVRPVHDAHV 219 S+MQ P P + H A +P HD V Sbjct: 112 SHMQFMQLPHPAAAHSALLSPAMPHNLTRHDGSV 145 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.0 bits (42), Expect = 8.5 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 76 NLHNPDSNDRSGSP 35 N +P S+DRSG+P Sbjct: 933 NSASPASSDRSGTP 946 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 116,255 Number of Sequences: 336 Number of extensions: 2343 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16188355 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -