BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31116 (650 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_1243 - 25527523-25527960,25527993-25528604 28 5.6 07_03_1187 + 24667044-24667091,24667196-24667274,24667520-246676... 27 9.8 >08_02_1243 - 25527523-25527960,25527993-25528604 Length = 349 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = -3 Query: 645 KRKKRNFWLFRNNLCYTSNWVIRIHCLS 562 +R+ R FWLFR C+ + RI CLS Sbjct: 19 RRRGRRFWLFRFRSCFLDRFRRRI-CLS 45 >07_03_1187 + 24667044-24667091,24667196-24667274,24667520-24667695, 24668216-24668766,24669080-24669941 Length = 571 Score = 27.5 bits (58), Expect = 9.8 Identities = 11/32 (34%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = -3 Query: 633 RNFWLFRNNLCYTSNWV--IRIHCLSSSYIHC 544 + WL+R+ + +WV RI C S+ HC Sbjct: 24 QRLWLYRSRFGFYYSWVWGYRISCFRSTQSHC 55 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,402,301 Number of Sequences: 37544 Number of extensions: 132722 Number of successful extensions: 262 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 255 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 262 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1620349964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -