BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31115 (728 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 28 0.089 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 28 0.089 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 28 0.089 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 28 0.089 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 26 0.36 AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory recept... 25 0.83 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 27.9 bits (59), Expect = 0.089 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -3 Query: 300 VPDLLHVIPVGDDTVLD 250 +PD+ +IP GDDT +D Sbjct: 355 LPDISEIIPTGDDTTMD 371 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 27.9 bits (59), Expect = 0.089 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -3 Query: 300 VPDLLHVIPVGDDTVLD 250 +PD+ +IP GDDT +D Sbjct: 355 LPDISEIIPTGDDTTMD 371 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 27.9 bits (59), Expect = 0.089 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -3 Query: 300 VPDLLHVIPVGDDTVLD 250 +PD+ +IP GDDT +D Sbjct: 355 LPDISEIIPTGDDTTMD 371 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 27.9 bits (59), Expect = 0.089 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -3 Query: 300 VPDLLHVIPVGDDTVLD 250 +PD+ +IP GDDT +D Sbjct: 355 LPDISEIIPTGDDTTMD 371 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 25.8 bits (54), Expect = 0.36 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = -1 Query: 215 WASSPT*ESFWPIPTITPWWRGRPTMDGKTAR 120 W + P+ ++W T +PWW T T R Sbjct: 1035 WTTKPS--TWWSSTTTSPWWTTTTTRRTTTTR 1064 >AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory receptor candidate 38 protein. Length = 436 Score = 24.6 bits (51), Expect = 0.83 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = +1 Query: 262 IITNWDDMEKIWHHTFYNELRVAPEEHPVLLT 357 ++T+W + E+I++ +L V PV+LT Sbjct: 158 VVTDWVNFERIYYKLTKKKLSVFFGNKPVILT 189 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,001 Number of Sequences: 336 Number of extensions: 3386 Number of successful extensions: 14 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19467635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -