BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31111 (703 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC29A4.19c |||P-type ATPase |Schizosaccharomyces pombe|chr 1||... 26 4.5 SPBC1734.14c |suc1||cyclin-dependent protein kinase regulatory s... 26 6.0 >SPAC29A4.19c |||P-type ATPase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1096 Score = 26.2 bits (55), Expect = 4.5 Identities = 15/46 (32%), Positives = 19/46 (41%) Frame = +2 Query: 548 PTDT*QLHSS*FANESTTGSESRPAEKIRRETQRADAWVRLHVELF 685 P D SS +ES ES PA K E D+W+ +F Sbjct: 291 PVDGILFSSSCLLDESMVTGESVPARKFPLEDNSLDSWMIASCNIF 336 >SPBC1734.14c |suc1||cyclin-dependent protein kinase regulatory subunit Suc1|Schizosaccharomyces pombe|chr 2|||Manual Length = 113 Score = 25.8 bits (54), Expect = 6.0 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = -1 Query: 220 EYKYRIIYIPKQIPQKLPVLHFN 152 EY+YR + +PK + + +P +FN Sbjct: 35 EYEYRHVMLPKAMLKAIPTDYFN 57 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,792,627 Number of Sequences: 5004 Number of extensions: 55451 Number of successful extensions: 109 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 107 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 109 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 325165428 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -