BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31111 (703 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z69664-5|CAE17882.2| 360|Caenorhabditis elegans Hypothetical pr... 29 3.2 Z70754-4|CAA94774.1| 130|Caenorhabditis elegans Hypothetical pr... 27 9.8 >Z69664-5|CAE17882.2| 360|Caenorhabditis elegans Hypothetical protein K04D7.6 protein. Length = 360 Score = 29.1 bits (62), Expect = 3.2 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 2/56 (3%) Frame = -1 Query: 169 PVLHFNTL*TFTDIKFELV--SNHFNIR*IKMFIVSETSCFKNMPLFMSIVYGVTL 8 PVL FNT+ T D+ F +V S F I I M +CF+ P+F+ I +G + Sbjct: 219 PVL-FNTVITIMDLLFMVVGISQQFPIPYIVM-TTYRYNCFEATPVFILIAFGALM 272 >Z70754-4|CAA94774.1| 130|Caenorhabditis elegans Hypothetical protein F58E6.4 protein. Length = 130 Score = 27.5 bits (58), Expect = 9.8 Identities = 10/27 (37%), Positives = 19/27 (70%) Frame = -1 Query: 88 IKMFIVSETSCFKNMPLFMSIVYGVTL 8 + + ++SET F+ P+F+SI+ G+ L Sbjct: 1 MSVHLLSETETFEMQPIFISILLGICL 27 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,372,229 Number of Sequences: 27780 Number of extensions: 307117 Number of successful extensions: 649 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 633 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 649 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1624019012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -