BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31110 (448 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U40419-9|AAA81429.2| 1715|Caenorhabditis elegans Hypothetical pr... 28 3.6 >U40419-9|AAA81429.2| 1715|Caenorhabditis elegans Hypothetical protein C27F2.8 protein. Length = 1715 Score = 27.9 bits (59), Expect = 3.6 Identities = 20/82 (24%), Positives = 43/82 (52%) Frame = -2 Query: 399 PSNRILRIETRIAYDIE*QNLRLAHKLILKKGSM*IPEQTQWLGEIHRHQILNSTMHVKI 220 P RI+RIE ++ +D+ N+ LA +L+ S+ + ++T + H + + K+ Sbjct: 365 PHQRIIRIENQLPFDVAIFNITLAPELV-SHFSVRLIDRTALIRSGHISPVFVLKYNKKL 423 Query: 219 *CPSFNGIETLWVQLNANRSNV 154 P+F+ T+++ N + N+ Sbjct: 424 -PPTFDN-STIYLHTNVSTFNL 443 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,351,020 Number of Sequences: 27780 Number of extensions: 211883 Number of successful extensions: 384 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 381 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 384 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 777938954 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -