BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31108 (751 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 24 1.1 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 3.4 AF264720-1|AAF75272.1| 126|Tribolium castaneum putative cytochr... 22 6.0 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 21 8.0 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 24.2 bits (50), Expect = 1.1 Identities = 17/61 (27%), Positives = 26/61 (42%) Frame = +2 Query: 485 SINLMFYVRGNKADYDEWAADGNEGWSFEEVLPYFKKSESFMGKFDAEATKYHSKGGYLS 664 SIN + +KAD +A G++ LP S S +G + YH+ G S Sbjct: 371 SINRLLPTAESKADIKMYADMHQYGYNTLSPLPSSVHSHSTIGNDYYNSPLYHTSAGTTS 430 Query: 665 V 667 + Sbjct: 431 L 431 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.6 bits (46), Expect = 3.4 Identities = 9/40 (22%), Positives = 16/40 (40%) Frame = +2 Query: 446 CAWPRGKVLGGSSSINLMFYVRGNKADYDEWAADGNEGWS 565 C WP G+S++N++ V K + W+ Sbjct: 1320 CDWPEKATCDGTSNVNVVDIVTTAKPAQSTTSVSTTTSWN 1359 >AF264720-1|AAF75272.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q1 protein. Length = 126 Score = 21.8 bits (44), Expect = 6.0 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = -3 Query: 575 LPRNSSLRFHRQPIRRNRPCYPE 507 LP+ S+ H + RN YP+ Sbjct: 81 LPKESNAIIHIYDVHRNADIYPD 103 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.4 bits (43), Expect = 8.0 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -1 Query: 721 YCSLDYQIFDFVHIIVRSYTEI 656 Y +LDY V I+ S TE+ Sbjct: 494 YLNLDYNDLSAVPIVTHSLTEL 515 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,780 Number of Sequences: 336 Number of extensions: 3655 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20027417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -