BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31104 (606 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7528| Best HMM Match : Aldo_ket_red (HMM E-Value=0) 139 1e-33 SB_34622| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_54717| Best HMM Match : Aldo_ket_red (HMM E-Value=0) 121 5e-28 SB_56309| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 8e-18 SB_8916| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 1e-16 SB_33699| Best HMM Match : Aldo_ket_red (HMM E-Value=3.1) 62 3e-10 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 33 0.24 SB_51365| Best HMM Match : ig (HMM E-Value=0.00037) 32 0.31 SB_19371| Best HMM Match : C_tripleX (HMM E-Value=0.041) 30 1.3 SB_23595| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_1127| Best HMM Match : Acetyltransf_1 (HMM E-Value=9.4e-19) 29 2.9 SB_53303| Best HMM Match : Pro-NT_NN (HMM E-Value=7.1) 29 3.9 SB_53172| Best HMM Match : ABC_tran (HMM E-Value=5.4e-40) 28 5.1 SB_17370| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_8703| Best HMM Match : rve (HMM E-Value=1.5e-22) 28 6.7 SB_53610| Best HMM Match : PPI_Ypi1 (HMM E-Value=5.8) 27 8.9 SB_28811| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 >SB_7528| Best HMM Match : Aldo_ket_red (HMM E-Value=0) Length = 407 Score = 139 bits (337), Expect = 1e-33 Identities = 73/161 (45%), Positives = 98/161 (60%), Gaps = 11/161 (6%) Frame = +2 Query: 152 SIDEVRQAVYWAIEAGYRHIDTAAVYQDEEQVGQGIAEAIANGLVTREELFVTTKLWNDK 331 S +EV AV AIE GYRHID A +Y +E ++G+ ++E + G V REELFVT+KLW D Sbjct: 63 SKEEVGNAVRLAIELGYRHIDCAEIYGNEGEIGEALSEVLTEGKVKREELFVTSKLWCDS 122 Query: 332 HARDQVVPALQESLKKLGLDYIDLYLIHFPIATK-----PDDSPDNI------DYLETWQ 478 H D V+PA Q +LK L LDY+DLYLIH P+A K P + I TWQ Sbjct: 123 HHPDDVLPACQATLKNLQLDYLDLYLIHIPVAFKKGVRLPHSIAEGIIGYTPEGVQNTWQ 182 Query: 479 GMQDARQLGLARSIGVSNFNATQITRLVSNSYIRPGXNQIE 601 M+ GL ++IGVSNF+ ++ +L+ + I P NQ+E Sbjct: 183 AMEGLVAKGLCKAIGVSNFSVKRLNKLLETASIVPACNQVE 223 >SB_34622| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 340 Score = 134 bits (324), Expect = 5e-32 Identities = 72/186 (38%), Positives = 114/186 (61%), Gaps = 11/186 (5%) Frame = +2 Query: 77 IQLNDGNTIPIVALGTGRGTAKESDSIDEVRQAVYWAIEAGYRHIDTAAVYQDEEQVGQG 256 ++LN+G +P++ LGT + +V AV +AI+ GYRHID A Y++E++VG Sbjct: 4 VKLNNGLEMPVLGLGTWKSKP------GQVENAVKFAIKEGYRHIDCAYAYRNEKEVGDA 57 Query: 257 IAEAIANGLVTREELFVTTKLWNDKHARDQVVPALQESLKKLGLDYIDLYLIHFPIATK- 433 + E + + +V R++LF+T+KLWN KH V +SLK LGLDY+DLYLIH+P++ + Sbjct: 58 LRELLGS-VVERKDLFITSKLWNTKHNPKDVRSNCVDSLKDLGLDYLDLYLIHWPLSFRD 116 Query: 434 -----PDDSPDNI-----DYLETWQGMQDARQLGLARSIGVSNFNATQITRLVSNSYIRP 583 P D N+ D +TW+ M+ GL ++IG+SNFN+ Q+ + + + I+P Sbjct: 117 GDEFFPKDEQGNVLYAYHDPCDTWKAMEKLVDEGLVKAIGLSNFNSKQVDDICAIARIKP 176 Query: 584 GXNQIE 601 NQ+E Sbjct: 177 VANQVE 182 >SB_54717| Best HMM Match : Aldo_ket_red (HMM E-Value=0) Length = 333 Score = 121 bits (291), Expect = 5e-28 Identities = 72/173 (41%), Positives = 101/173 (58%) Frame = +2 Query: 83 LNDGNTIPIVALGTGRGTAKESDSIDEVRQAVYWAIEAGYRHIDTAAVYQDEEQVGQGIA 262 +NDG IP++ LG A + S +QAV WA+E+GYR IDTA+ Y +E+ VG Sbjct: 70 MNDGRKIPLLGLG-----AHDIHS----KQAVLWALESGYRLIDTASRYHNEQSVG---- 116 Query: 263 EAIANGLVTREELFVTTKLWNDKHARDQVVPALQESLKKLGLDYIDLYLIHFPIATKPDD 442 EA+ + R E++V TK++ +H + + A +SL +LGL Y+DLYLIHFP+ Sbjct: 117 EAVRCSNIPRCEIYVVTKVYFTEHGYKETMDAFYKSLTRLGLGYVDLYLIHFPV------ 170 Query: 443 SPDNIDYLETWQGMQDARQLGLARSIGVSNFNATQITRLVSNSYIRPGXNQIE 601 P + + +WQ M D R GL RSIGVSNFN + L + + P NQIE Sbjct: 171 -PSGV--VGSWQAMIDLRSRGLIRSIGVSNFNIQHLEALRQQTGVVPAVNQIE 220 >SB_56309| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 394 Score = 87.4 bits (207), Expect = 8e-18 Identities = 51/140 (36%), Positives = 79/140 (56%) Frame = +2 Query: 182 WAIEAGYRHIDTAAVYQDEEQVGQGIAEAIANGLVTREELFVTTKLWNDKHARDQVVPAL 361 +A++ GYR +DTA +YQ+E++VG + ++ GL RE+++VTTKL + + Sbjct: 52 FALKNGYRMLDTADIYQNEKEVGSAVRKS---GL-KREDIYVTTKLKPSEEGHSNALKYA 107 Query: 362 QESLKKLGLDYIDLYLIHFPIATKPDDSPDNIDYLETWQGMQDARQLGLARSIGVSNFNA 541 +ES+KKL + Y+DL+LIH P P NI + + + ++ GL RS+GVSNF Sbjct: 108 KESIKKLDIGYVDLFLIHTP-------RPGNI--IAAYDALLTLKEEGLIRSVGVSNFGV 158 Query: 542 TQITRLVSNSYIRPGXNQIE 601 + L P NQIE Sbjct: 159 HHLEELRKAGCRTPAINQIE 178 >SB_8916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 619 Score = 83.8 bits (198), Expect = 1e-16 Identities = 57/168 (33%), Positives = 92/168 (54%), Gaps = 5/168 (2%) Frame = +2 Query: 77 IQLNDGNTIPIVALGTGRGTAKESDSIDEVRQAVYWAIEAGYRHIDTAAVYQDEEQVGQG 256 + L G T+P++ GT T E D++ V+ A +E GYR IDTA Y E Sbjct: 329 VLLASGYTMPVMGFGTA--TLGE-DTLSVVKTA----LETGYRLIDTAQGYPLSEPQ--- 378 Query: 257 IAEAIANGLVTREELFVTTKLWNDKHARDQVVPALQESLKKLGLDYIDLYLIHFP----- 421 +A+AIA+ + R+++F+ TKL + + +++ SL+ L DYIDL+LIH Sbjct: 379 VAKAIADSGIPRKDIFIITKLHPRYLGYEPTLKSVEMSLRALSTDYIDLFLIHSKTCDDF 438 Query: 422 IATKPDDSPDNIDYLETWQGMQDARQLGLARSIGVSNFNATQITRLVS 565 + T + P + E+W+ M++ + G RS+GVSNFN ++ LV+ Sbjct: 439 LLTCAEGEPRG-TWKESWKAMEELHRQGKIRSLGVSNFNVDELQELVN 485 >SB_33699| Best HMM Match : Aldo_ket_red (HMM E-Value=3.1) Length = 93 Score = 62.5 bits (145), Expect = 3e-10 Identities = 38/100 (38%), Positives = 55/100 (55%) Frame = +2 Query: 83 LNDGNTIPIVALGTGRGTAKESDSIDEVRQAVYWAIEAGYRHIDTAAVYQDEEQVGQGIA 262 L+DG IP LG K + +QAV WA+E GYR IDTAA Y +E++VG Sbjct: 3 LSDGYKIPRFGLGLYDLDEKHT------KQAVLWALENGYRMIDTAASYNNEKRVG---- 52 Query: 263 EAIANGLVTREELFVTTKLWNDKHARDQVVPALQESLKKL 382 EA+ V R E+++ TK+++ H ++ + A SL L Sbjct: 53 EALRESAVPRSEVYLVTKVYHTDHGYEKTMKAYDRSLSAL 92 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 32.7 bits (71), Expect = 0.24 Identities = 14/41 (34%), Positives = 29/41 (70%) Frame = +2 Query: 296 ELFVTTKLWNDKHARDQVVPALQESLKKLGLDYIDLYLIHF 418 EL +K+ + + +++ + ++SL++LG+D IDLYL+H+ Sbjct: 27 ELGTLSKVRPENASEMKMMLSCEKSLERLGIDRIDLYLLHW 67 >SB_51365| Best HMM Match : ig (HMM E-Value=0.00037) Length = 498 Score = 32.3 bits (70), Expect = 0.31 Identities = 20/85 (23%), Positives = 42/85 (49%), Gaps = 4/85 (4%) Frame = +2 Query: 341 DQVVPALQESLKKLGLDYIDLYLIHFPIATKPDDSPDNIDYLETWQGMQDARQLGLARSI 520 D+V+ + SLK++ D +D++ +H P P + E+ + + + G + Sbjct: 337 DRVLEQMNTSLKRMKRDKVDIFYLHAPDHKTPIE--------ESLKAVDQLHKEGKFKEF 388 Query: 521 GVSNFNATQITRLV----SNSYIRP 583 G+SN+ A ++ + +N+YI P Sbjct: 389 GLSNYAAWEVAEIYYLCKANNYILP 413 >SB_19371| Best HMM Match : C_tripleX (HMM E-Value=0.041) Length = 942 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/34 (41%), Positives = 23/34 (67%) Frame = +2 Query: 122 TGRGTAKESDSIDEVRQAVYWAIEAGYRHIDTAA 223 +G G+ ++ +I ++R Y A EAGY+H DTA+ Sbjct: 766 SGTGSIRDIPAISDIR---YGASEAGYKHDDTAS 796 >SB_23595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 281 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -2 Query: 515 TWPDPAAARPACLARFPDSRCYQENRQAL 429 +WP+ + C PDS C Q+ RQ L Sbjct: 158 SWPEARDEKQVCSNNLPDSTCTQKERQRL 186 >SB_1127| Best HMM Match : Acetyltransf_1 (HMM E-Value=9.4e-19) Length = 317 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 182 WAIEAGYRHIDTAAVYQDEEQVGQGIAEAIANGLVTREE 298 W G+RH +VY +Q GQG+ + L+ R + Sbjct: 219 WRAIEGFRHTVEHSVYVRSDQRGQGLGPRLMQALIERAQ 257 >SB_53303| Best HMM Match : Pro-NT_NN (HMM E-Value=7.1) Length = 266 Score = 28.7 bits (61), Expect = 3.9 Identities = 19/68 (27%), Positives = 35/68 (51%), Gaps = 1/68 (1%) Frame = +2 Query: 392 YIDLYLIHFPIATKPDDSPDNIDYLETWQGMQDARQLG-LARSIGVSNFNATQITRLVSN 568 +++ + I FP+ +PD ++L G D R +G + R + V +F + T ++ + Sbjct: 193 FLEKFKIFFPLDAPNKKTPDRPEHLRVIGGTSD-RMIGRITRKLFV-DFLCFRNTAILRS 250 Query: 569 SYIRPGXN 592 SY RP N Sbjct: 251 SYKRPVFN 258 >SB_53172| Best HMM Match : ABC_tran (HMM E-Value=5.4e-40) Length = 665 Score = 28.3 bits (60), Expect = 5.1 Identities = 15/47 (31%), Positives = 26/47 (55%) Frame = -2 Query: 158 LLSQTP*LFLVQFPKLLWV*YYHRSVVCKALAPPLLRSTNMLR*LFS 18 +L +P L ++ +L W YHR ++ ++ L + N+LR LFS Sbjct: 474 VLQASPSWILAKWDRLTWANAYHRGIIVAYIS--LTIAANVLRYLFS 518 >SB_17370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1743 Score = 27.9 bits (59), Expect = 6.7 Identities = 18/65 (27%), Positives = 34/65 (52%), Gaps = 1/65 (1%) Frame = +2 Query: 392 YIDLYLIHFPIATKPDDSPDNIDYLETWQGMQDARQLG-LARSIGVSNFNATQITRLVSN 568 +++ + I FP+ +PD ++L G D R +G + R + V +F + T ++ + Sbjct: 1089 FLEKFKIFFPLDAPNKKTPDRPEHLRVIGGTSD-RMIGRITRKLCV-DFLCFRNTSILRS 1146 Query: 569 SYIRP 583 SY RP Sbjct: 1147 SYKRP 1151 >SB_8703| Best HMM Match : rve (HMM E-Value=1.5e-22) Length = 382 Score = 27.9 bits (59), Expect = 6.7 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -2 Query: 254 PDRLAPRPGIRQPCRYVC 201 PDRL PR +R P R +C Sbjct: 346 PDRLRPRKVVRPPARLIC 363 >SB_53610| Best HMM Match : PPI_Ypi1 (HMM E-Value=5.8) Length = 175 Score = 27.5 bits (58), Expect = 8.9 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -2 Query: 254 PDRLAPRPGIRQPCRYVC 201 PDRL PR +R P R +C Sbjct: 110 PDRLRPRRVVRPPARLIC 127 >SB_28811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 982 Score = 27.5 bits (58), Expect = 8.9 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -2 Query: 254 PDRLAPRPGIRQPCRYVC 201 PDRL PR +R P R +C Sbjct: 946 PDRLRPRRVVRPPARLIC 963 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,184,454 Number of Sequences: 59808 Number of extensions: 386230 Number of successful extensions: 1022 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 948 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1011 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1475788250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -