BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31103 (666 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0449 - 24437994-24438157,24438265-24438383,24438489-24438760 64 1e-10 08_02_1388 + 26649874-26649905,26650243-26650365,26650980-266510... 52 5e-07 02_02_0595 + 11968298-11968329,11969405-11969438,11970216-119703... 52 5e-07 10_08_0985 - 22042801-22042963,22043019-22043138,22043261-220435... 49 3e-06 04_04_0436 + 25186144-25187915,25188020-25188077,25188472-25188888 31 0.62 01_03_0248 + 14235808-14235989,14236538-14236635,14237171-142372... 31 0.62 12_02_0387 + 18453328-18453456,18453699-18453836,18454085-184541... 28 5.8 07_03_1541 + 27575006-27575089,27575361-27575460,27575643-275757... 28 5.8 >03_05_0449 - 24437994-24438157,24438265-24438383,24438489-24438760 Length = 184 Score = 63.7 bits (148), Expect = 1e-10 Identities = 27/83 (32%), Positives = 45/83 (54%) Frame = +2 Query: 308 LYGFFLYLFSKTTLTMFCIWAFTPDSFLHYFNIYYYPQKYWSTALPIQFLVALTVFAFLI 487 +YGF + + T++ +WA+ P+ L I YYP +YW+ A+P F++ T ++ Sbjct: 53 VYGFVGSITTVIATTVYLVWAYMPERCLRSLGITYYPSRYWALAVP-SFVIVATALCMVV 111 Query: 488 YPSINMILTPHIDSPNTFQDKFS 556 Y N + TP S NT D++S Sbjct: 112 YVGFNFLATPPPTSFNTIFDEYS 134 >08_02_1388 + 26649874-26649905,26650243-26650365,26650980-26651013, 26651792-26651893,26652174-26652241,26652518-26652571, 26653139-26653211,26653428-26653537,26653615-26653719, 26653842-26653941,26653979-26654088,26656234-26656306, 26656429-26656484,26656576-26656702 Length = 388 Score = 51.6 bits (118), Expect = 5e-07 Identities = 25/74 (33%), Positives = 42/74 (56%) Frame = +2 Query: 23 QKTLKFSFTSNDNASLVYDVLNVDKELKGSGVHREFQLKSNVLYIEFKSLDLKRLRVAVN 202 Q + + S + AS+VY L VDKEL+ V RE + L + F++++ + LR + + Sbjct: 303 QSDFEIDYGSEERASIVYKTLAVDKELQPDKVKREMSVSGGKLVVHFEAVEARFLRASFS 362 Query: 203 AILKNILLITKTVE 244 A + +L+TK VE Sbjct: 363 AFVDLTVLVTKLVE 376 >02_02_0595 + 11968298-11968329,11969405-11969438,11970216-11970317, 11970598-11970665,11970942-11970995,11971563-11971635, 11971852-11971961,11972039-11972143,11972266-11972365, 11972403-11972512,11974664-11974736,11974859-11974914, 11975006-11975132 Length = 347 Score = 51.6 bits (118), Expect = 5e-07 Identities = 25/74 (33%), Positives = 42/74 (56%) Frame = +2 Query: 23 QKTLKFSFTSNDNASLVYDVLNVDKELKGSGVHREFQLKSNVLYIEFKSLDLKRLRVAVN 202 Q + + S + AS+VY L VDKEL+ V RE + L + F++++ + LR + + Sbjct: 262 QSDFEIDYGSEERASIVYKTLAVDKELQPDKVKREMSVSGGKLVVHFEAVEARFLRASFS 321 Query: 203 AILKNILLITKTVE 244 A + +L+TK VE Sbjct: 322 AFVDLTVLVTKLVE 335 >10_08_0985 - 22042801-22042963,22043019-22043138,22043261-22043562, 22044055-22044351,22044448-22044556,22044826-22045358, 22045446-22045644,22045741-22045865,22045937-22046020, 22046093-22046221,22046337-22046465,22046593-22046739, 22047106-22047346,22047859-22047980 Length = 899 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/81 (27%), Positives = 39/81 (48%), Gaps = 3/81 (3%) Frame = +2 Query: 284 PAPTPSRS---LYGFFLYLFSKTTLTMFCIWAFTPDSFLHYFNIYYYPQKYWSTALPIQF 454 P PSR YGF + + + WA+ P+ +L + + YYP ++W+ A+P Sbjct: 757 PTADPSRGSSEAYGFVGSIAAVAAAAAYLAWAYLPEPWLRFLGVTYYPARHWALAMP-SL 815 Query: 455 LVALTVFAFLIYPSINMILTP 517 L+ ++Y + N +L P Sbjct: 816 LLEAAAQGMVLYMASNFLLAP 836 >04_04_0436 + 25186144-25187915,25188020-25188077,25188472-25188888 Length = 748 Score = 31.5 bits (68), Expect = 0.62 Identities = 17/44 (38%), Positives = 22/44 (50%) Frame = +2 Query: 11 QYYLQKTLKFSFTSNDNASLVYDVLNVDKELKGSGVHREFQLKS 142 Q + T + FT SL Y+V + KEL+ REF LKS Sbjct: 84 QKLIDATARLEFTHKQCGSLQYEVRILQKELEIRNKEREFDLKS 127 >01_03_0248 + 14235808-14235989,14236538-14236635,14237171-14237204, 14237731-14237900,14238060-14238240,14238288-14238498, 14239122-14239233,14239360-14239487,14240201-14240263 Length = 392 Score = 31.5 bits (68), Expect = 0.62 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +2 Query: 14 YYLQKTLKFSFTSNDNASLVYDVLNVDKELKGSGVH 121 Y+L++ +F T N N S + V+N +KG+G+H Sbjct: 131 YFLKELYRFEDTDNPNKSAIPLVINTSGWVKGTGLH 166 >12_02_0387 + 18453328-18453456,18453699-18453836,18454085-18454144, 18461532-18462591,18463022-18463521 Length = 628 Score = 28.3 bits (60), Expect = 5.8 Identities = 25/104 (24%), Positives = 51/104 (49%), Gaps = 12/104 (11%) Frame = +2 Query: 23 QKTLKFSFTSNDNA---SLVYDVLNVD---KELKGSGVHREFQLKSNVLYIEFKS----- 169 Q L +F S +N +++DV+++ + G +F+ S+ Y++ K Sbjct: 504 QALLLIAFGSGENRREEQILFDVVDIPYNYNAIFGRATLNKFEAISHHNYLKLKMPGPTG 563 Query: 170 -LDLKRLRVAVNAILKNILLITKTVENLATK*PAMPEHTPAPTP 298 + +K L+ + A ++ +I + V ++ T+ P+HTP PTP Sbjct: 564 VIVVKGLQ-PLAASKGDLAMINRAVHSVETRPYERPKHTPKPTP 606 >07_03_1541 + 27575006-27575089,27575361-27575460,27575643-27575782, 27575948-27576163 Length = 179 Score = 28.3 bits (60), Expect = 5.8 Identities = 18/51 (35%), Positives = 26/51 (50%) Frame = +2 Query: 77 DVLNVDKELKGSGVHREFQLKSNVLYIEFKSLDLKRLRVAVNAILKNILLI 229 DV D+ LKGS + F LK ++ SLD L+ + I+ ILL+ Sbjct: 88 DVPASDRALKGSSLFGMFALKERPRWMRISSLD--ELKTKLGHIIVMILLV 136 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,064,803 Number of Sequences: 37544 Number of extensions: 318943 Number of successful extensions: 796 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 777 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 796 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1679486824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -