BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31103 (666 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34601| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_12148| Best HMM Match : DUF827 (HMM E-Value=0.044) 29 4.5 >SB_34601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1391 Score = 28.7 bits (61), Expect = 4.5 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = +3 Query: 555 LILQVKQMIKLFPQMVVFVRIVIIGEYKRYVDSKE 659 +++QVK +LFP +V+ V I I+ K+ VD E Sbjct: 1012 ILIQVKPREELFPDIVLRVFIAILSLTKQEVDGNE 1046 >SB_12148| Best HMM Match : DUF827 (HMM E-Value=0.044) Length = 933 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +2 Query: 188 RVAVNAILKNILLITKTVENLATK*PAMPEHTPAPTPSRS 307 + ++ + NI L+ + AT P + T PTPSRS Sbjct: 524 KALIDQLKNNIALLQREAAEAATSTPVRQDDTLPPTPSRS 563 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,628,215 Number of Sequences: 59808 Number of extensions: 397717 Number of successful extensions: 1028 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 918 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1027 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1717720750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -