BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31103 (666 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g61280.1 68414.m06907 expressed protein similar to SP|P57054 ... 67 9e-12 At2g15020.1 68415.m01710 expressed protein and genefinder 29 2.8 At5g45380.1 68418.m05577 sodium:solute symporter family protein ... 29 3.7 At3g02580.1 68416.m00249 delta 7-sterol-C5-desaturase (STE1) ide... 28 4.9 At1g11590.1 68414.m01330 pectin methylesterase, putative similar... 27 8.5 >At1g61280.1 68414.m06907 expressed protein similar to SP|P57054 Down syndrome critical region protein 5 (Down syndrome critical region protein C) {Homo sapiens}; expression supported by MPSS Length = 137 Score = 67.3 bits (157), Expect = 9e-12 Identities = 32/83 (38%), Positives = 44/83 (53%) Frame = +2 Query: 308 LYGFFLYLFSKTTLTMFCIWAFTPDSFLHYFNIYYYPQKYWSTALPIQFLVALTVFAFLI 487 +YGF + +F IW + PD FL IYYYP KYW+ A+P+ +V L V A + Sbjct: 16 VYGFVGSISIVVATVIFLIWGYVPDKFLESIGIYYYPSKYWAMAMPMYSMVTLLV-ALVF 74 Query: 488 YPSINMILTPHIDSPNTFQDKFS 556 Y +N + T S NT D +S Sbjct: 75 YIGLNFMSTSKPTSLNTLFDDYS 97 >At2g15020.1 68415.m01710 expressed protein and genefinder Length = 526 Score = 29.1 bits (62), Expect = 2.8 Identities = 20/87 (22%), Positives = 33/87 (37%) Frame = +2 Query: 281 TPAPTPSRSLYGFFLYLFSKTTLTMFCIWAFTPDSFLHYFNIYYYPQKYWSTALPIQFLV 460 T +PT F L K + + + + +P+SF FN+ + +W V Sbjct: 96 TRSPTTHDGACTKFEQLEIKPSPVSWVMDSHSPESFSSVFNLILLTRLFWLCVFDAPSEV 155 Query: 461 ALTVFAFLIYPSINMILTPHIDSPNTF 541 F L+ P +N + H TF Sbjct: 156 GSFFFQHLLGPHVNALTCQHAPVLRTF 182 >At5g45380.1 68418.m05577 sodium:solute symporter family protein contains Pfam profile: PF00474 sodium:solute symporter family Length = 694 Score = 28.7 bits (61), Expect = 3.7 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Frame = +2 Query: 458 VALTVFAFLIYPSINMILTPHIDSPNTFQDKFSDFTGKANDKT--FSSNGCIC 610 VAL VF FL+Y S + + SP+ D+ D K+ T S +G C Sbjct: 228 VALVVFVFLVYTS-----SKELGSPSVVYDRLKDMVAKSRSCTEPLSHHGQAC 275 >At3g02580.1 68416.m00249 delta 7-sterol-C5-desaturase (STE1) identical to sterol-C5-desaturase GB:AAD12944 GI:4234768 from [Arabidopsis thaliana] Length = 281 Score = 28.3 bits (60), Expect = 4.9 Identities = 15/55 (27%), Positives = 24/55 (43%) Frame = -3 Query: 577 ICFTCKIRKLILKSVWTINMWSKYHVNTWINQKSKYS*CYQKLYW*CCGPVFLWI 413 I FT I L ++++WT N+ H N W + Y + Y G +W+ Sbjct: 202 IHFTTHIGLLFMEAIWTANIHDCIHGNIWPVMGAGYHTIHHTTYKHNYGHYTIWM 256 >At1g11590.1 68414.m01330 pectin methylesterase, putative similar to fruit-specific pectin methylesterase GI:1617583 from [Lycopersicon esculentum] Length = 524 Score = 27.5 bits (58), Expect = 8.5 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = +3 Query: 576 MIKLFPQMVVFVRIVIIGEYKRYVDSKEN 662 ++K+F ++ + +V+IG K Y D K++ Sbjct: 2 LVKVFSFFILMITMVVIGVSKEYCDDKQS 30 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,895,342 Number of Sequences: 28952 Number of extensions: 287983 Number of successful extensions: 820 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 787 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 820 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1403159472 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -